[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57832.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  43/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:196 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->176 PF04600 * DUF571 4.8e-05 22.3 139/425  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57832.1 GT:GENE ABA57832.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1483507..1484097) GB:FROM 1483507 GB:TO 1484097 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57832.1 GB:DB_XREF GI:76883151 LENGTH 196 SQ:AASEQ MTEITSKTFTKERAPEIERVFGDLGKHWGWLLALGMLFIVLGTIALGMSVTLTVVTVLFFGVLLSIGGIFQIVEAFKCKGWRSVLLHILIALLYITAGVMLITEPIAGSLALTALLGGAFVATGVLRIVMGFHLKGTGVRWGWVVFAGVVSLVLGGMILFQWPVSALWVIGLLVAIEMLFHGWSYVMIALAAKSIR GT:EXON 1|1-196:0| TM:NTM 5 TM:REGION 25->47| TM:REGION 54->76| TM:REGION 83->105| TM:REGION 112->134| TM:REGION 149->171| SEG 46->65|lgmsvtltvvtvlffgvlls| SEG 107->126|agslaltallggafvatgvl| HM:PFM:NREP 1 HM:PFM:REP 31->176|PF04600|4.8e-05|22.3|139/425|DUF571| OP:NHOMO 50 OP:NHOMOORG 45 OP:PATTERN ---------------------------------------------------------11--------- --1-------------------------------------------------------------------------------------------------------------------------1---------------------1--1-------------------3-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--1-1-1-1---11-1111-1---------11--2---11-1111111--------------------------------------------------------------------------------------------------1----------------------------------------------------------------11--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------1111--------------------------1---------------------------------111-----1----------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEHHHHHHHcccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //