[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57841.1
DDBJ      :             Protein of unknown function DUF525
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  338/915 : Eukaryota  37/199 : Viruses  0/175   --->[See Alignment]
b.1.23
:142 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->136 1xq4C PDBj 1e-33 53.4 %
:RPS:PDB   48->120 2azaA PDBj 2e-04 21.9 %
:RPS:SCOP  24->142 1tzaA  b.1.23.1 * 5e-45 52.9 %
:HMM:SCOP  19->142 1tzaA_ b.1.23.1 * 5.3e-45 54.8 %
:RPS:PFM   35->119 PF04379 * DUF525 1e-28 64.7 %
:HMM:PFM   34->121 PF04379 * DUF525 3.1e-38 61.4 88/90  
:BLT:SWISS 16->142 APAG_THIDA 2e-42 61.4 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57841.1 GT:GENE ABA57841.1 GT:PRODUCT Protein of unknown function DUF525 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1495396..1495824) GB:FROM 1495396 GB:TO 1495824 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF525 GB:PROTEIN_ID ABA57841.1 GB:DB_XREF GI:76883160 InterPro:IPR007474 LENGTH 142 SQ:AASEQ MSNYRIVDALDNICFMEQPKPYKIIVEVATTFIEEQSDPAVARYVFAYTITIHNLGTIAVKLLTRHWVITDGEGQVREVRGQGVIGEQPSLKPGEQFCYTSGAMIETPVGTMHGCYGMVGEDGVTFDAEIAAFTLAMPGSLH GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 16->142|APAG_THIDA|2e-42|61.4|127/127| TM:NTM 1 TM:REGION 43->65| BL:PDB:NREP 1 BL:PDB:REP 20->136|1xq4C|1e-33|53.4|116/120| RP:PDB:NREP 1 RP:PDB:REP 48->120|2azaA|2e-04|21.9|73/129| RP:PFM:NREP 1 RP:PFM:REP 35->119|PF04379|1e-28|64.7|85/90|DUF525| HM:PFM:NREP 1 HM:PFM:REP 34->121|PF04379|3.1e-38|61.4|88/90|DUF525| RP:SCP:NREP 1 RP:SCP:REP 24->142|1tzaA|5e-45|52.9|119/132|b.1.23.1| HM:SCP:REP 19->142|1tzaA_|5.3e-45|54.8|124/0|b.1.23.1|1/1|ApaG-like| OP:NHOMO 393 OP:NHOMOORG 375 OP:PATTERN -------------------------------------------------------------------- --1------------------------------------------------------------------------------------------------1-111111111------------------------1------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--111------111111111111111111111111-11111111111-11111111111111111----------111111111-11111111111111-----------------1111-1111-111111111111111111111111111111111111111111111111111111111--------1111111-----------------------111111---------------------------111111-1-111-1111111111111111111---11-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------11111-------------------------1111111111111111111-------------1111111111111111111111111111------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------3-3----1-------------------------------------1-----11211111211---2-2112-222211115--11111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 84.5 SQ:SECSTR ###################ccccEEEEEEEEEcGGGccTTTTcEEEEEEEEEEEcccccHHHHccccEEEETTTHHHHHHHHTccEEcccccTTcEEEEEEEGGGccTTcccTTcTTcEETTccEEEEEEEEEEEEcTT### DISOP:02AL 1-2| PSIPRED cccEEEEEccccEEEEccccccEEEEEEEEEEEHHHcccccccEEEEEEEEEEEcccccEEEEEEEEEEEcccccEEEEEccEEEccccEEcccccEEEEEEEEEcccccEEEEEEEEEcccccEEEEEcccEEEccccccc //