[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57850.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.69.1
:439 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   41->235 1zkqA PDBj 2e-04 25.1 %
:RPS:PDB   255->313 1a7uA PDBj 8e-04 18.6 %
:RPS:SCOP  264->330 1l7aA  c.69.1.25 * 6e-04 14.9 %
:HMM:SCOP  74->331 1l7aA_ c.69.1.25 * 7.9e-10 18.8 %
:RPS:PFM   31->379 PF10142 * PhoPQ_related 1e-57 39.5 %
:HMM:PFM   31->379 PF10142 * PhoPQ_related 1.2e-123 43.2 347/367  
:BLT:SWISS 27->438 APRA_DICDI 2e-50 32.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57850.1 GT:GENE ABA57850.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1502103..1503422 GB:FROM 1502103 GB:TO 1503422 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57850.1 GB:DB_XREF GI:76883169 LENGTH 439 SQ:AASEQ MLSPFFGRSSRAVFLIIALFFITKPAFAGALEDYVRKPDPHYNWKLTEQKEEHWGTMAYLELVSQHWRNQFWSHRLIIAQPKEVRNPEIGLLLIAGEGDGEKYIERLKMLAQRAGAVAAVITQVPNQPLYNGLKEDALIAFTLAQFLKTGDETWPLLFPMVKSAVRGMDTLQAFLERAFQQKIEGFVVAGASKRGWTTWLTGAVDSRIKGLAPMVIDMLNMEQQLHWAEKAYGRQSEKINDYTELSLHQNQDDPAVAKLRSWIDPYEYRQHYTMPKLLLLGTNDPYWVVDSLRHYWNELPAPKLIFQTPNAGHDLNGGKQAMQTLAAFFQMIADGQDLPQLEWELPASDAGEPSVKVTSGQSVRAIRLWTATSEDRDFRDEHWSSRSLKILPGSRHAIAKVVIPEQGYRAYLFEVEMTTSTGHPYKLSTEARVLPDDIK GT:EXON 1|1-439:0| BL:SWS:NREP 1 BL:SWS:REP 27->438|APRA_DICDI|2e-50|32.7|410/100| BL:PDB:NREP 1 BL:PDB:REP 41->235|1zkqA|2e-04|25.1|183/482| RP:PDB:NREP 1 RP:PDB:REP 255->313|1a7uA|8e-04|18.6|59/277| RP:PFM:NREP 1 RP:PFM:REP 31->379|PF10142|1e-57|39.5|342/361|PhoPQ_related| HM:PFM:NREP 1 HM:PFM:REP 31->379|PF10142|1.2e-123|43.2|347/367|PhoPQ_related| RP:SCP:NREP 1 RP:SCP:REP 264->330|1l7aA|6e-04|14.9|67/318|c.69.1.25| HM:SCP:REP 74->331|1l7aA_|7.9e-10|18.8|245/0|c.69.1.25|1/1|alpha/beta-Hydrolases| OP:NHOMO 93 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- --1--------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------1111-1-----------1------------------1----------------------------1-----------------------------------------------------------------------------1------------------------------------------------------11--111111-111------------1-----------------------------------------------------------------1-1-------------------------------111111111-------------------------------------------------11---11111--- ----551----------------------------------------------------------------------------------------------------1-CD------------------------------------------------221-62--------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 242 STR:RPRED 55.1 SQ:SECSTR ########################################HTTccccccccccHHHHH##HHHHHHHHHHHHHHHHHH#HHTTcEEEccccccccccTTccccEEEEEEEEEcccEEEcccTTccTHHHHcccHHHHTcccccccEEEEcccHHHHHHHHHHHHT#TccEEcccccTTccHHHHHHHHHHHHTTT#cEEEETEEEEEEEEcT#######TccEEEEEEETTcccc###################HHHHHHTTcccTTTGGGccccEEEEEETTcccccGGGTHHHHHHHcTTcEEEEETTccT############################################################################################################################## DISOP:02AL 1-3, 6-7| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccEEEccEEEEEEEEEEEEcccccEEEEEEEEEccccccccEEEEEEccccccccccHHHHHHHHHHccEEEEEEEcccHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHcccHHHEEEHHHHHcccccHHHHHHHHHHHccccHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccHHEEEEEcccccccccccHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEccccccEEEEEEEEcccccccEEEEcccccccccccccEEEEEccccccccEEEEEEEEEEccccccEEEcccEEEcccccc //