[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57854.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:153 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57854.1 GT:GENE ABA57854.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1506444..1506905) GB:FROM 1506444 GB:TO 1506905 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57854.1 GB:DB_XREF GI:76883173 InterPro:IPR010916 LENGTH 153 SQ:AASEQ MAEFKQKFLTYLLCLVFFSSAASFANAADTSMEGYNQSRSPFPYTRIEDEPRYFRMIGDLLIARPLLLVATGLGTGIFLASLPFSALGGNVKEAADTLVVGPARQTFTRCLGCRISAFGLSGHAHTPETSIKESPSPSPTEKNIPSQEITPID GT:EXON 1|1-153:0| TM:NTM 2 TM:REGION 7->29| TM:REGION 62->84| SEG 17->28|ffssaasfanaa| OP:NHOMO 16 OP:NHOMOORG 16 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------1----------------------------1----------------------------------------------------------------------------------------------------------11------------------------1----1111--1-1----1111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 127-149, 152-153| PSIPRED cHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccc //