[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57863.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   16->60 PF03223 * V-ATPase_C 0.00016 31.1 45/371  
:HMM:PFM   65->78 PF01954 * DUF104 0.00058 50.0 14/60  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57863.1 GT:GENE ABA57863.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1517960..1518214 GB:FROM 1517960 GB:TO 1518214 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57863.1 GB:DB_XREF GI:76883182 LENGTH 84 SQ:AASEQ MILPIDHPVDDDLIEVGTLTRREVSQVVVAYSFDLRSNELETTLVANPNAGREHIFKAYRIEGDPLDPVSLREQEKVIAAQKVK GT:EXON 1|1-84:0| HM:PFM:NREP 2 HM:PFM:REP 16->60|PF03223|0.00016|31.1|45/371|V-ATPase_C| HM:PFM:REP 65->78|PF01954|0.00058|50.0|14/60|DUF104| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 59-59,62-62| PSIPRED cEEcccccccccHHHHccccHHHHcEEEEEEEEEcccccEEEEEEEcccccHHHHHHHHEEcccccccccHHHHHHHHHHHccc //