[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57867.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  233/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
b.1.3b.69.8d.111.1
:541 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   313->404 2c4xA PDBj 2e-13 38.0 %
:RPS:PDB   313->395 1e1bA PDBj 2e-10 15.0 %
:RPS:PDB   416->535 1cfeA PDBj 2e-20 12.8 %
:RPS:SCOP  315->400 1l0qA1  b.1.3.1 * 4e-11 20.5 %
:RPS:SCOP  416->535 1cfeA  d.111.1.1 * 9e-21 12.8 %
:HMM:SCOP  75->264 1txvA_ b.69.8.1 * 0.00045 18.7 %
:HMM:SCOP  313->400 1l0qA1 b.1.3.1 * 8.8e-22 40.0 %
:HMM:SCOP  410->535 1smbA_ d.111.1.1 * 5.3e-21 32.4 %
:RPS:PFM   322->390 PF00801 * PKD 3e-09 46.8 %
:RPS:PFM   420->526 PF00188 * CAP 6e-12 37.4 %
:HMM:PFM   421->536 PF00188 * CAP 7.8e-22 27.6 116/124  
:HMM:PFM   320->387 PF00801 * PKD 4e-15 40.0 65/69  
:HMM:PFM   243->268 PF01839 * FG-GAP 0.00011 39.1 23/33  
:HMM:PFM   377->424 PF02010 * REJ 0.00032 33.3 48/440  
:BLT:SWISS 268->402 K0319_HUMAN 3e-09 35.8 %
:BLT:SWISS 405->522 Y689_BORBU 5e-07 31.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57867.1 GT:GENE ABA57867.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1520571..1522196) GB:FROM 1520571 GB:TO 1522196 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57867.1 GB:DB_XREF GI:76883186 InterPro:IPR000601 InterPro:IPR001283 LENGTH 541 SQ:AASEQ MYLNRRMLCFAFFISALCSLSTVAFAIEEKLAIIKDNVNRRGLTLQVYTPPLAPENRLEAKLFQDVQIFGNVASLAAGNVSGAAGDEFIFLTHGRFGSNGLYLYTVKPEDGALFFRLLADDRSLERNVQFATLCDCDSDPEKELAVIKRLQNGSHQLIIYDLPTRRRGNALAIAGAANIGNNIIGLSAGDMAGDSKSELVIAQKNGNGTVRVEIYSPPSSLSDSLGPPLLSYSDLGRDIIPDGLAVGDFDNDSEDEIALVRSLKNGTYSLDILKAPTAFEDEAPVFIASDVNIGQNVAKITAFKIKAAGPSFNQPPQAVINANPQKGPLPLTVTLDGSNSQDADGFIQHYRWEFDNGQIITGPNLEYTYDTPGAHVVTLTVIDNENSKDSTQITIEVTEAANNNDTTDSQNLLPAEQELIKLINQERQKHNLASLKIHSALVAAAKGHSKDMAQNNFISHRGSNGSSPFTRMADAGYRFRTAGENVAAGYSSPQAVLTGWMNSPGHRRNILNASYCELGVGYAYQGRSTYRHYWTLTLGCR GT:EXON 1|1-541:0| BL:SWS:NREP 2 BL:SWS:REP 268->402|K0319_HUMAN|3e-09|35.8|134/1072| BL:SWS:REP 405->522|Y689_BORBU|5e-07|31.2|109/155| SEG 168->186|gnalaiagaanignniigl| SEG 215->236|ysppsslsdslgppllsysdlg| BL:PDB:NREP 1 BL:PDB:REP 313->404|2c4xA|2e-13|38.0|92/246| RP:PDB:NREP 2 RP:PDB:REP 313->395|1e1bA|2e-10|15.0|80/187| RP:PDB:REP 416->535|1cfeA|2e-20|12.8|117/135| RP:PFM:NREP 2 RP:PFM:REP 322->390|PF00801|3e-09|46.8|62/66|PKD| RP:PFM:REP 420->526|PF00188|6e-12|37.4|107/122|CAP| HM:PFM:NREP 4 HM:PFM:REP 421->536|PF00188|7.8e-22|27.6|116/124|CAP| HM:PFM:REP 320->387|PF00801|4e-15|40.0|65/69|PKD| HM:PFM:REP 243->268|PF01839|0.00011|39.1|23/33|FG-GAP| HM:PFM:REP 377->424|PF02010|0.00032|33.3|48/440|REJ| RP:SCP:NREP 2 RP:SCP:REP 315->400|1l0qA1|4e-11|20.5|83/90|b.1.3.1| RP:SCP:REP 416->535|1cfeA|9e-21|12.8|117/135|d.111.1.1| HM:SCP:REP 75->264|1txvA_|0.00045|18.7|187/0|b.69.8.1|1/1|Integrin alpha N-terminal domain| HM:SCP:REP 313->400|1l0qA1|8.8e-22|40.0|85/0|b.1.3.1|1/1|PKD domain| HM:SCP:REP 410->535|1smbA_|5.3e-21|32.4|111/149|d.111.1.1|1/1|PR-1-like| OP:NHOMO 483 OP:NHOMOORG 251 OP:PATTERN 11-------------------------1----------111111----------------------1- 112-2----------11----1---------------1---2231---------------22--4121331-----------3-----------------11--2-------------------------------11123---3-42-1--------------2113321------------323------22222222223222222232222222132431311111152-111111-111111-11111----------------------------------------------------------------------1521422222221213211-111225--21-1111223-12-1-111--1--1---1-------1111111111111111111111--------111--1---11-111--11----312222112-----------------------------------------------------------------------------------------11----------------------------1--1---------------1-----------21----------------------------------11--------------------------2-----------------------------------------------------------------------------------------------------1111--5-----------------111111----1111111121111121222-------------1------1--------------------111------------1---------------------------------------- ----22-------------------------------------------------------------------------------------------------------2-------------------------------------------2----------------------------------------ROMS- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 270 STR:RPRED 49.9 SQ:SECSTR ##########################################################################################################################################################################################################################################################EEccccEEEEETTTccEEE######cEEcTTccEEETTEEEEcccccccEEEEEccTTcEEcEEEEETTTTEEEccccEEccccEEEEEEEEEEEccccEEEEEEETTTEcccGGGTcEEccccccEEEEEEETTTEEEEEEEccEEEcccccccccEE######HHHHHHHHHHHHHHTTccccEEccHHHHHHHHHHHHHTTTccccccccccccEEccccccHHHHHHHHHTTGGGEEGGGTE#EccccccccHHHHHcTTccEEEEEEEEcTT##ccEEEE###### DISOP:02AL 1-2| PSIPRED cccccHHHHHHHHHHHHHHHHHHEEHHHHcEEEEEcccccccEEEEEEcccccccccHHHHHHHHHHHHccHHHHcccccccccccEEEEEEEEEEcccEEEEEEEEccccEEEEEEEEccccccccccEEEEEEcccccEEEEEEEEEEEccccEEEEEEEcccccccEEEEEcEEEcccEEEEEEEcccccccccccEEEccccccEEEEEEccccccEEcccccccEEccccccEEEcccEEEEEEccccccEEEEEEcccccEEEEEEEcccccccccccEEEEEEEEEEEEEccEEEEEEEEEEcccccccEEEEEEEcEEEEccEEEEEcccccccccccEEEEEEEcccccccccccEEEEEcccccEEEEEEEEcccccccccccccEEEccccccccccccccEEEEcccccHHHHHHHccccccEEEcHHHHHHHHHHHHHHHHccEEcccccccccHHHHHHHcccccEEEEEEEEcccccHHHHHHHHHccccHHHHHccccccEEEEEEEEcccccccEEEEEEEccc //