[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57876.1
DDBJ      :             Heat shock protein DnaJ-like
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  905/915 : Eukaryota  196/199 : Viruses  2/175   --->[See Alignment]
a.2.3a.4.5b.4.1d.227.1
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->75 1hdjA PDBj 5e-20 54.2 %
:BLT:PDB   211->308 3i38K PDBj 1e-17 42.3 %
:RPS:PDB   4->84 2ctwA PDBj 8e-21 37.0 %
:RPS:PDB   129->296 2b26A PDBj 1e-31 21.2 %
:RPS:SCOP  1->80 2nraC1  a.4.5.10 * 5e-19 15.4 %
:RPS:SCOP  167->310 2d7vA1  d.227.1.1 * 4e-19 7.3 %
:HMM:SCOP  1->125 1gh6A_ a.2.3.1 * 6.5e-28 50.0 %
:HMM:SCOP  129->212 1c3gA1 b.4.1.1 * 1.3e-17 38.8 %
:HMM:SCOP  213->297 1c3gA2 b.4.1.1 * 7.1e-17 41.2 %
:RPS:PFM   5->65 PF00226 * DnaJ 8e-15 63.9 %
:RPS:PFM   201->286 PF01556 * DnaJ_C 2e-16 43.0 %
:HMM:PFM   121->208 PF01556 * DnaJ_C 5.8e-09 26.3 76/101  
:HMM:PFM   200->292 PF01556 * DnaJ_C 6.7e-27 41.9 93/101  
:HMM:PFM   5->66 PF00226 * DnaJ 1.3e-28 66.1 62/64  
:BLT:SWISS 1->311 CBPA_COXBU 2e-70 43.4 %
:PROS 46->65|PS00636|DNAJ_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57876.1 GT:GENE ABA57876.1 GT:PRODUCT Heat shock protein DnaJ-like GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1531738..1532679 GB:FROM 1531738 GB:TO 1532679 GB:DIRECTION + GB:PRODUCT Heat shock protein DnaJ-like GB:PROTEIN_ID ABA57876.1 GB:DB_XREF GI:76883195 InterPro:IPR001623 InterPro:IPR002939 InterPro:IPR003095 LENGTH 313 SQ:AASEQ MEFKDYYQIMDIKRDATQDEIKRAYRKLARKYHPDVSKEPEAEVRFKEVGEAYEVLKDPEKRAAYDQLGANWKEGQDFRPPPDWDQGFEFHGGGFTGGDAEQFSDFFESLFGRGGFGGRRQREFHARGEDTYAKILIDLEDAYQGATRTLTLKHSELGPDGRPQLKERMLNVRIPKGVRQGQNIRLTGQGGAGAGKGGAGDLYLEVEFKPHPFYKAEGKDIYLNLPVAPWEAALGATVKVPTPSGTVDLKIPPNSWSGRKLRLKGRGIPAKESGDFYVVLEIALPKADTDKAKAVYAEFEKALGFNPRARLGV GT:EXON 1|1-313:0| BL:SWS:NREP 1 BL:SWS:REP 1->311|CBPA_COXBU|2e-70|43.4|309/313| PROS 46->65|PS00636|DNAJ_1|PDOC00553| SEG 87->98|gfefhgggftgg| SEG 106->124|ffeslfgrggfggrrqref| SEG 188->200|gqggagagkggag| BL:PDB:NREP 2 BL:PDB:REP 4->75|1hdjA|5e-20|54.2|72/77| BL:PDB:REP 211->308|3i38K|1e-17|42.3|97/103| RP:PDB:NREP 2 RP:PDB:REP 4->84|2ctwA|8e-21|37.0|81/109| RP:PDB:REP 129->296|2b26A|1e-31|21.2|151/157| RP:PFM:NREP 2 RP:PFM:REP 5->65|PF00226|8e-15|63.9|61/63|DnaJ| RP:PFM:REP 201->286|PF01556|2e-16|43.0|86/95|DnaJ_C| HM:PFM:NREP 3 HM:PFM:REP 121->208|PF01556|5.8e-09|26.3|76/101|DnaJ_C| HM:PFM:REP 200->292|PF01556|6.7e-27|41.9|93/101|DnaJ_C| HM:PFM:REP 5->66|PF00226|1.3e-28|66.1|62/64|DnaJ| GO:PFM:NREP 3 GO:PFM GO:0031072|"GO:heat shock protein binding"|PF00226|IPR001623| GO:PFM GO:0006457|"GO:protein folding"|PF01556|IPR002939| GO:PFM GO:0051082|"GO:unfolded protein binding"|PF01556|IPR002939| RP:SCP:NREP 2 RP:SCP:REP 1->80|2nraC1|5e-19|15.4|78/135|a.4.5.10| RP:SCP:REP 167->310|2d7vA1|4e-19|7.3|137/155|d.227.1.1| HM:SCP:REP 1->125|1gh6A_|6.5e-28|50.0|108/0|a.2.3.1|1/1|Chaperone J-domain| HM:SCP:REP 129->212|1c3gA1|1.3e-17|38.8|80/80|b.4.1.1|1/2|HSP40/DnaJ peptide-binding domain| HM:SCP:REP 213->297|1c3gA2|7.1e-17|41.2|85/90|b.4.1.1|2/2|HSP40/DnaJ peptide-binding domain| OP:NHOMO 5052 OP:NHOMOORG 1129 OP:PATTERN ------------------------21111111111--------2212211212--------111--22 2222322222222222222-222222222222222222532333222222223322332222223323222222222232223222122222121111123212234232111111111111111-1111111121333332222264644467733333233443444662313222333422212211211111111111111111111111111111121221111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111121111211221141222212213111111113222222422221233232222222222222222222124223232233142223333333322222112111111122222222222222331111111111111111111111111111112233222222211112211111123111111112232222231211222223213342111112222222222415232232222222222222323222222223552212222222222222222222221222211212122312222122111211112111-1221211111121111112222222222-22222222222222222222221111222222222222222222222222211211111111111111122222322222223111121111-1111122222122222111112222122221333222222222322211111111111222222222222221122111111111111112-111111-1111152---1112111111111111111221 IB58IEG-mHF29AIABAB9DBBBBA9A98B9BACC8B9A6BA9ABCDAABCADA8A8AAAB9C99A826B9ABB8A4896A9A79A9-CFDBBCCC76D98CJHG-9jBXcobZYMEDCCIMFgWEXE**T1XRYEFBEZAJVNBCGCCKCEeGOLOLDIKGKFHDcGHYEGQDALJJ*EDBIFhef*AqRHEKJNKI --------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--1- STR:NPRED 284 STR:RPRED 90.7 SQ:SECSTR cccccHHHHHTccTTccHHHHHHHHHHHHHHccTTTTTcHHHHHHHHHHHHHHHHHTcHHHHHHHHHTcHHHHHHHHHTcTTHHETTccEEEccccccc########################cHHHHcEEEEEEEEcHHHHHHTcccEEEEEEccTTcccETEEEEEEEEccccTTccTTcEEcEccccccccccccccEEEEEEEEcccccEEEETTEEEEEEEEcTGGGTcccccEEEcTTcEEEccccccccTTcEEEEEEEEEETTcEEEEEEEEEEcccccccHHHHHHcHHHcHHHTcccc##### DISOP:02AL 1-2, 69-84, 111-129, 298-313| PSIPRED ccccccHHHccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccEEEEEcccHHHHHcccEEEEEEEEEEEccccccEEEEEEEEEEcccccccccEEEEEcccccccccccccEEEEEEEEEccccEEEccccEEEEEEccHHHHccccEEEEEcccEEEEEEEccccccccEEEEccEEEcccccccEEEEEEEEEcccccHHHHHHHHHHHHHcccccHHcccc //