[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57881.1
DDBJ      :             Heat shock protein Hsp20
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  20/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.15.1
:124 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   27->123 2byuA PDBj 3e-14 15.5 %
:RPS:SCOP  21->114 1gmeA  b.15.1.1 * 1e-12 17.0 %
:HMM:SCOP  17->117 1shsA_ b.15.1.1 * 6.8e-17 23.8 %
:RPS:PFM   30->114 PF00011 * HSP20 2e-07 25.0 %
:HMM:PFM   35->121 PF00011 * HSP20 4.5e-16 18.8 85/102  
:BLT:SWISS 20->112 HSPC4_RICFE 8e-09 24.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57881.1 GT:GENE ABA57881.1 GT:PRODUCT Heat shock protein Hsp20 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1538793..1539167) GB:FROM 1538793 GB:TO 1539167 GB:DIRECTION - GB:PRODUCT Heat shock protein Hsp20 GB:PROTEIN_ID ABA57881.1 GB:DB_XREF GI:76883200 InterPro:IPR002068 LENGTH 124 SQ:AASEQ MATYFSSMKQVFINSEEQAYQESVWQPPADIYRIERGWLVKLDLAGIRNEDIHLSIHEQRLVVQGLRRDWIVEAGQQYYSMEIAYNRFRRAIEFPAPLEQARITTKYRDGMLLIWLEVTSQEGL GT:EXON 1|1-124:0| BL:SWS:NREP 1 BL:SWS:REP 20->112|HSPC4_RICFE|8e-09|24.7|93/163| RP:PDB:NREP 1 RP:PDB:REP 27->123|2byuA|3e-14|15.5|97/101| RP:PFM:NREP 1 RP:PFM:REP 30->114|PF00011|2e-07|25.0|84/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 35->121|PF00011|4.5e-16|18.8|85/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 21->114|1gmeA|1e-12|17.0|94/150|b.15.1.1| HM:SCP:REP 17->117|1shsA_|6.8e-17|23.8|101/115|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 20 OP:NHOMOORG 20 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------1---------------------1------------------------------1----11------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----1--111-----1---11----------------------11------------------------------------1-----------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 102 STR:RPRED 82.3 SQ:SECSTR #####################ccEEEccEEEEEcccEEEEEEEcTTccGGGEEEEEETTTEEEEEccccccccTTccccccccccccEEEEEEccccccGGGcEEEEETTEEEEEEccccccc# DISOP:02AL 1-2, 8-22, 69-70, 75-76, 122-124| PSIPRED ccccccccHHHHcccccccccccccccEEEEEEcccEEEEEEEcccccHHcEEEEEEccEEEEEEEccccccccccEEEEEEEEccEEEEEEEcccccccccEEEEEEccEEEEEEcccccccc //