Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57930.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
:311 amino acids
:RPS:SCOP  45->300 1rcwA  a.132.1.4 * 1e-07 19.3 %
:HMM:SCOP  45->300 1rcwA_ a.132.1.4 * 2.8e-14 22.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57930.1 GT:GENE ABA57930.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1597838..1598773 GB:FROM 1597838 GB:TO 1598773 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57930.1 GB:DB_XREF GI:76883249 InterPro:IPR006162 LENGTH 311 SQ:AASEQ MNTSVQQLHNFAEKHHLVGLSAPSLQALMEGRTGYSTSKARRFLSFQDRINRELLSHRIILHNRYTDWFKRGEQNLEQIKAFIVQFSVFSNQFLVAQLFKTINADSLESMRASKEILANEIGVVFNPGRGKVKKVSDLEREGDPKLVSTEGTVEGGVFRFQAAHFEWLLQIAHKIGLGFNEVGKRSQGTPATLFFCDELNRLYGSEDYRISQASSYAVENWAAAGFWDELIEGFSKFNRRTGIALPLAFFTWHSRLEAQHARHTQEELEEVYFSREIKENEFISYGNEMLAGVAAFWDGLEDQRKALAAVH GT:EXON 1|1-311:0| PROS 101->116|PS00012|PHOSPHOPANTETHEINE|PDOC00012| RP:SCP:NREP 1 RP:SCP:REP 45->300|1rcwA|1e-07|19.3|212/213|a.132.1.4| HM:SCP:REP 45->300|1rcwA_|2.8e-14|22.3|211/0|a.132.1.4|1/1|Heme oxygenase-like| OP:NHOMO 5 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------3-----------------------------------------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccHHHHHHHHHHHHHccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccc //