[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57939.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:461 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57939.1 GT:GENE ABA57939.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1607596..1608981) GB:FROM 1607596 GB:TO 1608981 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57939.1 GB:DB_XREF GI:76883258 LENGTH 461 SQ:AASEQ MRGAPPPYLANFDSASAMLRALSRFLNGKDFPALGQSRLLEPLTQMVNWLPSTARKKIFALGGSFEAVAPEKMPQVSAEAVAHWMVNQYPRRQYPAMMIGSSNGALIHLCAALQIPWLPQTYLIPVRQSTDPDDPKQALKLGRKAGQALLEANPELQLHHMHDPSQDRLMVQYITYFRVKRRCLGPSYERFLKDHLAPGGTLFVVDCQRTWPTTQVGERYVFQHGAVGGVSEEEYLQGGPRVNHFLERMGSSVRHWEPPTPDGESPEAEWGFEPLLGEDIKAFAKRQGHHVKRIVFSQPEQVSPLVADLYQWWYGQRGILSNRLLIESFILMEPWWTLRLGAVPFWMVFNMEPSAQRLENYLNSRAPYDNIHMMLFAHGVESIGLPPIERWQALLKQARGVNGFIGVDTKSYPSDFSTFARYHKDLHKIHGRHPLPSPLSLNQLYEFLAQADNRYAVHWRS GT:EXON 1|1-461:0| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------11----1---------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 257-264| PSIPRED cccccccEEEEcccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHccccccccHHHHcccccHHHHHHHHHcccccccEEEEEEEcccccccHHHHHHHHHHccHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHcccccccHHHHHcccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHEEccHHHHHHccccEEEEEcccccHHHHHHHHHHcccccHHHHHHHHHcHHHcccccHHHHHHHHHHHcccccEEEcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccEEEcc //