[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57969.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  30/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   26->177 3d00A PDBj 5e-09 18.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57969.1 GT:GENE ABA57969.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1643290..1643928) GB:FROM 1643290 GB:TO 1643928 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57969.1 GB:DB_XREF GI:76883288 LENGTH 212 SQ:AASEQ MSFPNFFDEAPVVRVRDPLAQLLGASADGIIDYRYADAVRLAGHSCPTVVGAFLTGRAALAALYPDTLPERGGVTVQMPAPEHDGTSGVMAQVLTLLTGAAGGGGFKGLGGRFARNSLLDFASASGTNGGAVHFKRLDTGTAVAVSFNAGTVPMDAAQQKRIMAVLQGYADTEVLAAFAEAWQDRVRRLLLEHADDPETIHVTELITGDNAA GT:EXON 1|1-212:0| SEG 94->115|ltlltgaaggggfkglggrfar| RP:PDB:NREP 1 RP:PDB:REP 26->177|3d00A|5e-09|18.7|123/180| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN ------------------------1------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------1--------------------1---------------------------------------------------------1111-1----------------1---1----11-----11111111111-1--------------------------------1-------------------1-111-----------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 123 STR:RPRED 58.0 SQ:SECSTR #########################cccccTTccHHHHHHHHccccHHHHHHH######HHHHHHHTccT#TccEEEEEcccccHHHHHHHHccccTTTTcE##############EEccccc#######EEEEEETTTcEEEEEEEcGGGcccHHH#HHHHTTcccHHHHHHHHHH################################### DISOP:02AL 210-212| PSIPRED cccHHHHHHccEEEEHHHHHHHHccccccEEEEEHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccEEEEccccccccHHHHHHHHHHHHHccccccccccccccHHHHHcccccccccccccEEEEEEcccccEEEEEEccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccc //