[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57970.1
DDBJ      :             Protein of unknown function DUF59
Swiss-Prot:             

Homologs  Archaea  35/68 : Bacteria  402/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.52.8
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->102 1uwdA PDBj 6e-18 40.6 %
:RPS:PDB   8->103 3cq2B PDBj 1e-27 43.6 %
:RPS:SCOP  3->102 1uwdA  d.52.8.2 * 1e-24 39.4 %
:HMM:SCOP  2->103 1uwdA_ d.52.8.2 * 6.5e-29 47.5 %
:RPS:PFM   8->82 PF01883 * DUF59 2e-13 47.3 %
:HMM:PFM   8->82 PF01883 * DUF59 2.2e-25 41.9 74/76  
:BLT:SWISS 8->102 YITW_BACSU 4e-19 46.8 %
:PROS 82->88|PS00092|N6_MTASE

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57970.1 GT:GENE ABA57970.1 GT:PRODUCT Protein of unknown function DUF59 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1644415..1644735 GB:FROM 1644415 GB:TO 1644735 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF59 GB:PROTEIN_ID ABA57970.1 GB:DB_XREF GI:76883289 InterPro:IPR002052 InterPro:IPR002744 LENGTH 106 SQ:AASEQ MSESTLNQDEIIVALHEVIDPEAGVSIVDLGLIYHIQMYERRIDIRMTMTTPACPLHESIRAEIKAAIGRCLPEISEVSVELVWDPPWHPDRMSERAKRQLGWFGR GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 8->102|YITW_BACSU|4e-19|46.8|94/102| PROS 82->88|PS00092|N6_MTASE|PDOC00087| BL:PDB:NREP 1 BL:PDB:REP 6->102|1uwdA|6e-18|40.6|96/102| RP:PDB:NREP 1 RP:PDB:REP 8->103|3cq2B|1e-27|43.6|94/97| RP:PFM:NREP 1 RP:PFM:REP 8->82|PF01883|2e-13|47.3|74/76|DUF59| HM:PFM:NREP 1 HM:PFM:REP 8->82|PF01883|2.2e-25|41.9|74/76|DUF59| RP:SCP:NREP 1 RP:SCP:REP 3->102|1uwdA|1e-24|39.4|99/102|d.52.8.2| HM:SCP:REP 2->103|1uwdA_|6.5e-29|47.5|101/0|d.52.8.2|1/1|Fe-S cluster assembly (FSCA) domain-like| OP:NHOMO 525 OP:NHOMOORG 437 OP:PATTERN ----11-2111111121112111-1-------------------1-----11--11111111111-11 -11-1111111111111----11111-----11---111121111111111111111111111111111111111111----2-11-1111111111--11111111211--------------------------23321---12-------11-----------1----------------11123---1-1--------1------111111---13311--111111--1111111111111111111113--11-213333221111-12111111111112112222222222211111111111112221112221----------------------------3------------------1--1-11111111111-1222211111111111111112-1131121221111111212111222211111111111111111111111111111-----------------------------111111------------2222----122222-----2-------1-11--2--------2-------------1-1------------------------22121---1111----------------1--21-----111-1--1---------------------1211----------------------------------------------------------------------------------------------11111111111111--------------------------1-----------------111111111---------------11111111111111----111111------------------------------------1111111111121 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 91.5 SQ:SECSTR #####ccHHHHHHHHTTcEETTTTEETTTTTcEEEEEEEETTEEEEEcccccccccccHHHHHHHHHHHT#cTTccEEEEEEcccccccGGGccHHHHHHHTc### DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHcccccccccEEEcccEEEEEEEccEEEEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEEccccHHHccHHHHHHHHHccc //