[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57971.1
DDBJ      :             NnrS-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  19/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:356 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   4->354 PF05940 * NnrS 7e-20 34.7 %
:HMM:PFM   1->343 PF05940 * NnrS 1.2e-54 35.6 337/379  
:BLT:SWISS 5->82 CDSA_BRUSU 2e-04 36.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57971.1 GT:GENE ABA57971.1 GT:PRODUCT NnrS-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1645071..1646141 GB:FROM 1645071 GB:TO 1646141 GB:DIRECTION + GB:PRODUCT NnrS-like protein GB:PROTEIN_ID ABA57971.1 GB:DB_XREF GI:76883290 InterPro:IPR010266 LENGTH 356 SQ:AASEQ MPGWLAILQGWISAPGPYWHGHEMLLGYAFAVVSGYLISRVSLVTVGLLFVSWFAARLAALGLMGEGWQAALPGLIFAGLAAYFAASPFLRAAKKLENRVFGPLFIGIGICELIYQLGVSKVVPGAEPFALLMAVDLFALLLLLMGGRVIAPAVAGHFHRRGEVLAARVQPRLERTAILCMLGMIILDMIPGAAPAGGIFALGASAVTAIRAWRWRLWRVLDTPHLWALGLGYLWLVPGLGLKGWAQLTGSLSLDWAFHGITVGALGTLTLVVMARTRLQRSRQGLEDFRDIGVAALGVSLAAILRLGAPLADGEYMFLLLWGSAIAWSVAFSLLLRRLILIYRKGPEGARKRPEY GT:EXON 1|1-356:0| BL:SWS:NREP 1 BL:SWS:REP 5->82|CDSA_BRUSU|2e-04|36.0|75/270| TM:NTM 9 TM:REGION 33->55| TM:REGION 71->93| TM:REGION 100->122| TM:REGION 131->153| TM:REGION 193->214| TM:REGION 226->248| TM:REGION 255->276| TM:REGION 289->311| TM:REGION 316->336| SEG 130->144|allmavdlfalllll| SEG 190->204|ipgaapaggifalga| SEG 334->342|lllrrlili| RP:PFM:NREP 1 RP:PFM:REP 4->354|PF05940|7e-20|34.7|337/379|NnrS| HM:PFM:NREP 1 HM:PFM:REP 1->343|PF05940|1.2e-54|35.6|337/379|NnrS| OP:NHOMO 21 OP:NHOMOORG 19 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----11------------------------------------------------------------------------------------------------------------------------1-------------------1-------------------------------------------------------------------11--1--1------------1--1------2-----------------------------------------------------------------------------------------------1---------------------------------------------------1----------------1111-------2--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 353-356| PSIPRED ccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //