[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57972.1
DDBJ      :             ABC-type phosphate/phosphonate transport system periplasmic component
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:248 amino acids
:SECSTR
:PSIPRED
:RPS:PDB   28->114 2de2A PDBj 7e-06 16.3 %
:RPS:SCOP  28->140 1xs5A  c.94.1.1 * 2e-04 18.2 %
:HMM:SCOP  4->229 1xs5A_ c.94.1.1 * 4.9e-11 22.9 %
:HMM:PFM   36->132 PF03180 * Lipoprotein_9 3e-06 18.9 95/237  
:BLT:SWISS 34->129 PLPC_PASHA 4e-05 31.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57972.1 GT:GENE ABA57972.1 GT:PRODUCT ABC-type phosphate/phosphonate transport system periplasmic component GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1646195..1646941) GB:FROM 1646195 GB:TO 1646941 GB:DIRECTION - GB:PRODUCT ABC-type phosphate/phosphonate transport system periplasmic component GB:PROTEIN_ID ABA57972.1 GB:DB_XREF GI:76883291 LENGTH 248 SQ:AASEQ MSYNFTVSPDFTPDHLSGWYIFNTWLQKALGEAVHLEMYNDFQTQRDAIDAGKVDLIYANPYDTSMLVREKGFTALVKPKDEADEATVAVHTRSPAKTVEDLEAGVKVAITNDPDIHMVGLIMLEPADLNSANIQLNIRDNYLMVAKDLLRGESDVGIFLAEAFDNLSSMVKSQLRILVSSQIRLIHHSLMLGPALADKQEKLLGALMGMMENEKGQGVLKSLGFSGWEAVNQENTEFMIDLMDTLVV GT:EXON 1|1-248:0| BL:SWS:NREP 1 BL:SWS:REP 34->129|PLPC_PASHA|4e-05|31.5|92/100| RP:PDB:NREP 1 RP:PDB:REP 28->114|2de2A|7e-06|16.3|86/347| HM:PFM:NREP 1 HM:PFM:REP 36->132|PF03180|3e-06|18.9|95/237|Lipoprotein_9| RP:SCP:NREP 1 RP:SCP:REP 28->140|1xs5A|2e-04|18.2|110/241|c.94.1.1| HM:SCP:REP 4->229|1xs5A_|4.9e-11|22.9|218/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2-----1-----------------------------------------------------------------------------------11--------1----------1------1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 203 STR:RPRED 81.9 SQ:SECSTR ##########EcEEEcHHHHHHHHHHHHHTTEEEEEccccTTccccGGGcTTEEEEEccHHHHHHHHTTcTTcEEEEEEEEEcccEEEEEcTTcccccGGGGGTTcEEEEcHHHcTTTTHHHHTcccGGGTccEEEcTTccTTcTTcTTcccccccccTTcccTTcTTcHHHHHHHHHHTTccTTcHHHHHHHHHHTTccccEEEEccHHHHH################################### PSIPRED cEEEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccEEEEEEEEcccccccHHHHcccEEEEccccHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEEcccccccEEEEccccHHHHHHHHHHHHcccccHHHHHHHHcccccccEEccHHHHHHHHHHHHHHcc //