[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57973.1
DDBJ      :             PAS domain protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  328/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.13.2d.110.3
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   44->149 3ewkA PDBj 4e-19 41.5 %
:RPS:PDB   6->114 3bs2A PDBj 3e-18 10.1 %
:RPS:SCOP  44->146 2ookA1  c.13.2.2 * 3e-22 13.7 %
:HMM:SCOP  40->140 1g28A_ d.110.3.6 * 7.1e-27 33.7 %
:RPS:PFM   39->140 PF00989 * PAS 2e-12 37.4 %
:HMM:PFM   55->138 PF08447 * PAS_3 2.2e-16 30.1 83/91  
:BLT:SWISS 32->157 AER_ECOLI 4e-32 42.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57973.1 GT:GENE ABA57973.1 GT:PRODUCT PAS domain protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1646965..1647441) GB:FROM 1646965 GB:TO 1647441 GB:DIRECTION - GB:PRODUCT PAS domain protein GB:PROTEIN_ID ABA57973.1 GB:DB_XREF GI:76883292 InterPro:IPR000014 LENGTH 158 SQ:AASEQ MIRDMVPEDIVGDYRQAMLDLYGIGPRRILYTEMETPYPDGRLIVSRTDPEGRITHCNQSFVDMSGYAKEELIGVPHSILKHPDIPPTIYKDLWDTLKRGDKWQGFIKNLRKDGGYYWVKATVLPNIRNGKVIGYTSVRRKASHKKIEECIGQYPSLF GT:EXON 1|1-158:0| BL:SWS:NREP 1 BL:SWS:REP 32->157|AER_ECOLI|4e-32|42.9|126/506| BL:PDB:NREP 1 BL:PDB:REP 44->149|3ewkA|4e-19|41.5|106/227| RP:PDB:NREP 1 RP:PDB:REP 6->114|3bs2A|3e-18|10.1|109/146| RP:PFM:NREP 1 RP:PFM:REP 39->140|PF00989|2e-12|37.4|99/112|PAS| HM:PFM:NREP 1 HM:PFM:REP 55->138|PF08447|2.2e-16|30.1|83/91|PAS_3| GO:PFM:NREP 1 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00989|IPR013767| RP:SCP:NREP 1 RP:SCP:REP 44->146|2ookA1|3e-22|13.7|102/125|c.13.2.2| HM:SCP:REP 40->140|1g28A_|7.1e-27|33.7|101/0|d.110.3.6|1/1|PYP-like sensor domain (PAS domain)| OP:NHOMO 752 OP:NHOMOORG 335 OP:PATTERN ------------------------211---17-----------------------------------2 --1---1-------------------------------------1---1--------------1---------------------213------------423---1-1-------------------13---131111---------2-33---11-------2-11--1------------1-------2--11111111-111111------111---1---11111121----------------------------------------------------------------------------------------------------------------------2---------------------------1-------21211152335-------------------1-------1--------1---1----1-1-1------------1-E35-----------------------------------121-32222223222111112222122221221--1126222231-6--116324248-------11-1CF223---11-23----535731321--------B1222333312---------FB657--65213-5113423444-5243352332543---3421------2154-211111111111-1111111111111111111-1-55--11111111111111111-111---1--111111111111---1-----11112-112----1----------------1---3122225632445434223---------7-214433431213311--------------A-441111-----------------------------------------------4- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 91.8 SQ:SECSTR #####EEEEEEETTTTEEEEEEEcccGGGccccEEEEEEEETTEEEETTEEEEEEEEccccEEEEEETTEEEEEEEGGGTTcTTcccHHHHHHHHHHTTTcccEEcccTTcccccEEEEEEEEEEcEEcccEEEEEEEEEEcHHHHHHHT######## DISOP:02AL 1-2, 22-24, 26-28| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccEEEEcHHHHHHHcccHHHHcccccEEEEcccccHHHHHHHHHHHHcccEEEEEEEEEEccccEEEEEEEEEEEEEccEEEEEEEEEEcHHHHHHHHHHHHHHHcc //