[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57974.1
DDBJ      :             Roadblock/LC7
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:120 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   8->119 1acfA PDBj 7e-05 15.0 %
:RPS:SCOP  18->117 1j3wA  d.110.7.1 * 9e-15 23.0 %
:HMM:SCOP  4->120 1j3wA_ d.110.7.1 * 1.1e-26 39.7 %
:RPS:PFM   25->95 PF03259 * Robl_LC7 2e-06 39.4 %
:HMM:PFM   17->96 PF03259 * Robl_LC7 3.3e-18 33.8 80/91  
:BLT:SWISS 1->119 Y714_METJA 1e-16 38.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57974.1 GT:GENE ABA57974.1 GT:PRODUCT Roadblock/LC7 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1647543..1647905) GB:FROM 1647543 GB:TO 1647905 GB:DIRECTION - GB:PRODUCT Roadblock/LC7 GB:PROTEIN_ID ABA57974.1 GB:DB_XREF GI:76883293 InterPro:IPR004942 LENGTH 120 SQ:AASEQ MRADMLTAVLNDLNSTSADIEASGVISTDGLMIAAVLPTTLDEDRVGAMSAAMLSLGDRSAKELERGALEQVLIKGDHGYVLMTYAGDEAVLTVMAKPRAKLGLIFLDVKRAAESIASMI GT:EXON 1|1-120:0| BL:SWS:NREP 1 BL:SWS:REP 1->119|Y714_METJA|1e-16|38.5|117/118| RP:PDB:NREP 1 RP:PDB:REP 8->119|1acfA|7e-05|15.0|107/125| RP:PFM:NREP 1 RP:PFM:REP 25->95|PF03259|2e-06|39.4|71/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 17->96|PF03259|3.3e-18|33.8|80/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 18->117|1j3wA|9e-15|23.0|100/134|d.110.7.1| HM:SCP:REP 4->120|1j3wA_|1.1e-26|39.7|116/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 60 OP:NHOMOORG 43 OP:PATTERN ----------------------------------313111111----------1-------------- ----------------------------------------1------------------------------------------1-112----------------------------------------------2-11122---3----2---11----------1-------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------2-----2-------------1111111-------1-------------------------------------------------------22---------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 107 STR:RPRED 89.2 SQ:SECSTR #######TTGGGTcccEEEE#####EETTccEEEEcTTccccHHHHHHHHHHHHccHHHHHHcEEETTEEEEEEEEcccEEEEEEEcccEEEEEEEcTTccHHHHHHHHHHHHHHHHTT# DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHHHHccccEEEEEEcccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHc //