[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57975.1
DDBJ      :             TonB-dependent receptor
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  214/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.4.3
:689 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->508 1nqgA PDBj 9e-12 24.5 %
:RPS:PDB   24->689 1by5A PDBj 4e-34 13.5 %
:RPS:SCOP  34->689 1nqeA  f.4.3.3 * 2e-38 19.0 %
:HMM:SCOP  34->689 1nqeA_ f.4.3.3 * 1.1e-88 26.4 %
:RPS:PFM   55->152 PF07715 * Plug 2e-08 45.6 %
:HMM:PFM   426->687 PF00593 * TonB_dep_Rec 2.2e-23 21.2 259/277  
:HMM:PFM   47->152 PF07715 * Plug 1.2e-19 35.2 105/108  
:BLT:SWISS 23->689 Y964_NEIMB 1e-72 34.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57975.1 GT:GENE ABA57975.1 GT:PRODUCT TonB-dependent receptor GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1648088..1650157 GB:FROM 1648088 GB:TO 1650157 GB:DIRECTION + GB:PRODUCT TonB-dependent receptor GB:PROTEIN_ID ABA57975.1 GB:DB_XREF GI:76883294 InterPro:IPR000531 LENGTH 689 SQ:AASEQ MQVIILRWASLCWGMLFLLPFFKAQAMDDAVALEALVVTADPLGRSEEDILQPTSVLMGKALSIKDKRNIGEAVAGELGVTSSDFGPAVGRPIIRGLGGTRVRVLEDGIGAMDVSAISPDHAVAVQPFFADQIEIFKGPATLLYGSGAIGGVVNIVDHRILDYVPEAIEGDVYGHYDSVADDATGVFRFNAGAGDFAFHLAGLLRDTEDYGIPGFAQVNPEPGAKSGTLANSDVHTKNFTGGLSLVRDEGFLGLAVSRLTNEYGVPGEHGHEDEAGQAHEEGGVRIDQAQTRLDIKGTLYLPLAGIQTIKTRWGHNDHTHQEFEPSGLASTILNNKEWEGRVEFLHTPFGEWEGVAGLQYRNRDLSARGEEAFMPPSSRMDSISVFILEERAWRRWHFEMGGRFEHQVAKKSEGGPHASHNLFSISGGAMWDFWKDYAVGFNVSHSERAPALEELFSEGPHLATNTFEIGNPFLNKEISNNLDLSLRKTRSHWHWKLNLFANFISDFIFLQEQDKNGDGIADRVNLEGEPSMDPDGLLLVNEKQADAEFFGVEFETVIGLFEDHRGKLDLRLWTDYVRGKLKNGANLPRITPLRFGSELDYERGPGYAGINLMRVQAQDETAALETETGGYTLLKVYMGYRFALGPVQYAVFLRGTNLLNEKARRHTSFLKNQAPLPGRSAMVGVNATF GT:EXON 1|1-689:0| BL:SWS:NREP 1 BL:SWS:REP 23->689|Y964_NEIMB|1e-72|34.1|637/758| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 34->508|1nqgA|9e-12|24.5|417/576| RP:PDB:NREP 1 RP:PDB:REP 24->689|1by5A|4e-34|13.5|623/697| RP:PFM:NREP 1 RP:PFM:REP 55->152|PF07715|2e-08|45.6|90/108|Plug| HM:PFM:NREP 2 HM:PFM:REP 426->687|PF00593|2.2e-23|21.2|259/277|TonB_dep_Rec| HM:PFM:REP 47->152|PF07715|1.2e-19|35.2|105/108|Plug| GO:PFM:NREP 4 GO:PFM GO:0004872|"GO:receptor activity"|PF07715|IPR012910| GO:PFM GO:0005215|"GO:transporter activity"|PF07715|IPR012910| GO:PFM GO:0006810|"GO:transport"|PF07715|IPR012910| GO:PFM GO:0016020|"GO:membrane"|PF07715|IPR012910| RP:SCP:NREP 1 RP:SCP:REP 34->689|1nqeA|2e-38|19.0|541/549|f.4.3.3| HM:SCP:REP 34->689|1nqeA_|1.1e-88|26.4|575/589|f.4.3.3|1/1|Porins| OP:NHOMO 268 OP:NHOMOORG 216 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------1111--------1211212111------------------------31------------------------------3--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3--1111-------11112212111----------1-22-22221--3--22-----------211------------------------1-------------------------------1111-121111111111111111--1111-111-111111----11111-1-1-11-1312--111111111111----1------------------1---------1--1-----------------------11-1122131--1111--1212-11----1---1-1-------1------1--11---11--11111-111--1--1-------2--2-----------------------1-----------------1---------121--111--------11142132212--211111112-2-11112------------1-11-111111--112211111-111111------1111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 683 STR:RPRED 99.1 SQ:SECSTR ######GEEEHHHHHHTcccccccTTcccccccccEEcTTTcccEEGGGccccEEEEEHHHHHHHccccHHHHTTTcTTEEccTTTTcccccccEETTTccccEEETTEEccccccccTTccccccGGGEEEEEEEEcccHHHHccccTTEEEEEEEcccccccEEEEEEEEETTTEEccccccEEEEEEEEEEEEEEEEEEEEEEEccccTcccTTcccccTTcccccTTcEEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEEEEEEEEETTcGGGTTcHHHHTccGGGGGcEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEEEEEEEEEcTTcEEEEEcccccccccccccccTTcEEEEEEEEEEEEEEEEEEEEEEETTEEEEEEEEEEEEEEEETccEEEEEEEEEEEEEEEEEccTTcEEEEEEEEEEEEcccHHHHHccccccccccccTTccccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEEEEEEEEEcccccccEEEcccccccccTTEEEEEccEEEEEEEEEEEEEEEcccccccccEEEEEEEEEEEcTTTTTcccTTcccEEEEEEEEEEccccTTTEEEEEEccEEccTTcccEEccEEEEEEEEEEETTTTcTTcEEEEEEEcTTccccEEEEEETTEEEEccccEEEEEEEEEc DISOP:02AL 689-690| PSIPRED ccEEEEHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHccccEEEEcHHHHHHHccccHHHHHHHcccEEEcccccccccEEEEEEccccEEEEEccEEEcccccccccccccccHHHHEEEEEEEcccccccccccccEEEEEEEcccccccccEEEEEEEEEEccccccEEEEEEEcccccEEEEEEEEEEEEcccccccccccccccccccccEEcccccEEEEEEEEEEEEccccEEEEEEEEcccccccccccccccccccccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEEcccccEEEEEEEccEEEEEEEEEEcccccEEEEEEEEEEEcEEEEcccccccccccEEEEEEEEEEEEEEEccEEEEEEEEEEEEEEcccccccccccccEEEEEEEEEEccccEEEEEEEEEEEEcccHHHHHcccccccccEEEccccccccEEEEEEEEEEEEEcccEEEEEEEEEEEEccEEEEEEccccccccccccccccccccccccEEEEEEEccEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEcccEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEEEcccccccccccccEEEEEEEEEc //