[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57983.1
DDBJ      :             Protein-tyrosine kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  499/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.1.7c.37.1
:753 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   481->721 3bfvA PDBj 1e-30 31.9 %
:RPS:PDB   199->300 3di2C PDBj 2e-15 10.8 %
:RPS:PDB   481->723 3bfvA PDBj 5e-31 32.5 %
:RPS:SCOP  245->430 1gveA  c.1.7.1 * 3e-04 14.3 %
:RPS:SCOP  551->725 1a82A  c.37.1.10 * 7e-19 13.3 %
:HMM:SCOP  549->754 1ionA_ c.37.1.10 * 3e-41 32.8 %
:RPS:PFM   44->210 PF02706 * Wzz 1e-10 28.1 %
:RPS:PFM   219->427 PF12128 * DUF3584 3e-06 24.9 %
:RPS:PFM   555->723 PF01656 * CbiA 4e-09 32.7 %
:HMM:PFM   43->210 PF02706 * Wzz 1.6e-23 25.9 147/152  
:HMM:PFM   554->727 PF01656 * CbiA 2.3e-15 32.3 133/194  
:HMM:PFM   245->427 PF10498 * IFT57 0.00022 17.6 176/359  
:BLT:SWISS 251->720 PTK_ACIJO 4e-35 30.2 %
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57983.1 GT:GENE ABA57983.1 GT:PRODUCT Protein-tyrosine kinase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1659108..1661369 GB:FROM 1659108 GB:TO 1661369 GB:DIRECTION + GB:PRODUCT Protein-tyrosine kinase GB:PROTEIN_ID ABA57983.1 GB:DB_XREF GI:76883302 InterPro:IPR003856 LENGTH 753 SQ:AASEQ MSNEEQSHLPVPNPQSAGALADRPSSSMAFPQSGEYRGHHDEDEINLLDLWQILVRRKWTVIVFFLIVTTAGITASFLMTPIYRAGVTLLIDREPPKVVDYQEIAPVESPASREDFYQTQYGLLKSRSLAKQVFEELDLAHHPVFAVEQKPSFWSRLMSKEEETGGQEKEKLIERFQEEITVEPVRNSRLVKIYYDSPDPELSAQVVETLGQAFITANLERRYDATAYARDFLKDRLLQVKARLEETEQKLVEYANNHEIITFEEGQSLAAQNLKEISASLSEAQQERAKAKALYQQMQKTKGQGLSQVLQSSMIQQLKESLVRLEGEYGENLHIYKPDYPKMKQLRDQIDKLEGKIDGEVKNIRTAIQSNYEAAVSLENLLASKVKAAKEEIKDLAQRSIEYQVLKRETDTNRQLYEGLLQRYKEVGVAGGVGLNNISVVDPAKIPLEFHTPNIPLNTLVAMLLGLFGGIGLAFLFEHLDDTLKQSEDMERVLGLSVLGLIPAIPKPDKSLSGEGGLALISIEDKRSAFAEAYRSVRTALQFSTPEGAPKSLLVVSTSKGEGKSTTAASLAIHFAQAGQKVLLVDGDLRSPSLHRILETPNDTGLTHYLAGEATPVDISQPTTIPNLFLITTGPLPPDPAGLLGSAKMMSLLSTAKEKFDHVIVDSPPVLGLADALILGNLVDGTLFVVAAGHTRRAFAQGAIKRLEMGHTRLLGGILNKFDSRSHGYGYHDYYYYQGDSSPSLLSSDQKVA GT:EXON 1|1-753:0| BL:SWS:NREP 1 BL:SWS:REP 251->720|PTK_ACIJO|4e-35|30.2|437/733| COIL:NAA 32 COIL:NSEG 1 COIL:REGION 270->301| TM:NTM 1 TM:REGION 65->87| SEG 160->171|keeetggqekek| SEG 464->477|llglfggiglaflf| SEG 634->645|gplppdpagllg| SEG 726->742|shgygyhdyyyyqgdss| BL:PDB:NREP 1 BL:PDB:REP 481->721|3bfvA|1e-30|31.9|238/241| RP:PDB:NREP 2 RP:PDB:REP 199->300|3di2C|2e-15|10.8|102/110| RP:PDB:REP 481->723|3bfvA|5e-31|32.5|240/241| RP:PFM:NREP 3 RP:PFM:REP 44->210|PF02706|1e-10|28.1|153/160|Wzz| RP:PFM:REP 219->427|PF12128|3e-06|24.9|209/1179|DUF3584| RP:PFM:REP 555->723|PF01656|4e-09|32.7|153/178|CbiA| HM:PFM:NREP 3 HM:PFM:REP 43->210|PF02706|1.6e-23|25.9|147/152|Wzz| HM:PFM:REP 554->727|PF01656|2.3e-15|32.3|133/194|CbiA| HM:PFM:REP 245->427|PF10498|0.00022|17.6|176/359|IFT57| GO:PFM:NREP 2 GO:PFM GO:0009103|"GO:lipopolysaccharide biosynthetic process"|PF02706|IPR003856| GO:PFM GO:0016020|"GO:membrane"|PF02706|IPR003856| RP:SCP:NREP 2 RP:SCP:REP 245->430|1gveA|3e-04|14.3|168/324|c.1.7.1| RP:SCP:REP 551->725|1a82A|7e-19|13.3|173/224|c.37.1.10| HM:SCP:REP 549->754|1ionA_|3e-41|32.8|201/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 894 OP:NHOMOORG 501 OP:PATTERN -------------------------------------------------------------------- 244----111--1--------1--1-------1111-221-11112111331222-1-----1--------11111-1--212-----1154-611---4-1221322-1-----------------12111112133344---217235223-------1--11237782--------1---111--11---2-----22--22-222111112223111111-------141222222222222221--11-1-1-11111112--12121111---111----1--1-111111111-------------1111111111---311111111-11----12211-211-11-1--211-2---111----1-21111-----514522-23212322222222223-22212416342-255245444424-1211---23221-----------22--121------------------------------2122-2----4223451----22762222124483242----134-1--22-3-2241222---------44224--2212-41--1111-222-3142211313243------------------------11-1-13--2-311------1--------1------12-1------11-2-212221211122-23221212122112222211112111-1111111111111111212121221--------------------------3131----111-----1--1111111111112----1-21-11112111-----------2311111122133--111111111111--2-----------------1--------------------------111-11111142 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 473 STR:RPRED 62.8 SQ:SECSTR ###############################################################################################################################################################################ccHHHHHHHHTcTTTcEETTEEEcHHHHHHTHHHHHHHHHHTTccccTTccccccHHHHHccccHHHHHHHHHHHHHTTcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHTccGGGcccHHHHccEHHHHHHHHHHHHHHHTcTTcccccHHHHHTTHHHHHHHHHHHHTTcGGGccTTHHHHHHHHHHHHHH#############################################################################TccccccHHHHHHHHcccEEEEEEcccTTTTTcccccccccHHHHcTTcHHHHHHHHHHHHHHHccTTccccEEEEEcccTTccHHHHHHHHHHHHHHTTccEEEEEcccccccHHHHTTccccccHHHHHTTcccHHHHEEEcccTTEEEEccccccccHHHHHTcHHHHHHHHHHHHHccEEEEEcccTTTccHHHHHHHHHcEEEEEEETTcccHHHHHHHHHHHHTTTcEEEEEEEEEEccc############################ DISOP:02AL 1-45, 93-117, 163-164, 218-231, 259-274, 295-312, 326-343, 346-400, 424-437| PSIPRED cccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccHHHHHHHHHHHccEEEEEcccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccEEEcccHHHHHHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccHHHHHcccccHHHHHEEcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccEEEcccccccHHcHHHHcc //