[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57992.1
DDBJ      :             Protein of unknown function UPF0150
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.304.1
:107 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   26->100 2dsyD PDBj 6e-20 56.2 %
:RPS:PDB   37->100 2dsyA PDBj 9e-13 56.2 %
:RPS:SCOP  32->100 2dsyA1  d.304.1.2 * 1e-20 56.5 %
:HMM:SCOP  34->94 1wv8A1 d.304.1.1 * 1.7e-07 37.7 %
:RPS:PFM   22->56 PF09818 * ABC_ATPase 5e-04 47.1 %
:HMM:PFM   40->81 PF03681 * UPF0150 7.4e-14 38.1 42/48  
:HMM:PFM   17->49 PF05350 * GSK-3_bind 0.00044 24.2 33/217  
:BLT:SWISS 44->81 Y960_HELPJ 9e-04 39.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57992.1 GT:GENE ABA57992.1 GT:PRODUCT Protein of unknown function UPF0150 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1671148..1671471 GB:FROM 1671148 GB:TO 1671471 GB:DIRECTION + GB:PRODUCT Protein of unknown function UPF0150 GB:PROTEIN_ID ABA57992.1 GB:DB_XREF GI:76883311 InterPro:IPR005357 LENGTH 107 SQ:AASEQ MAAKGLHGNANCSKASELVWNKRTRLSRKLQEEALNRAHYEMIEDDEPYYGEIKELRGIWATGKTLEECRRNLKDAIEGWLLLSIRRGLPVPKLGDYEIKEGEDVMA GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 44->81|Y960_HELPJ|9e-04|39.5|38/100| BL:PDB:NREP 1 BL:PDB:REP 26->100|2dsyD|6e-20|56.2|73/79| RP:PDB:NREP 1 RP:PDB:REP 37->100|2dsyA|9e-13|56.2|64/78| RP:PFM:NREP 1 RP:PFM:REP 22->56|PF09818|5e-04|47.1|34/444|ABC_ATPase| HM:PFM:NREP 2 HM:PFM:REP 40->81|PF03681|7.4e-14|38.1|42/48|UPF0150| HM:PFM:REP 17->49|PF05350|0.00044|24.2|33/217|GSK-3_bind| RP:SCP:NREP 1 RP:SCP:REP 32->100|2dsyA1|1e-20|56.5|69/80|d.304.1.2| HM:SCP:REP 34->94|1wv8A1|1.7e-07|37.7|61/0|d.304.1.1|1/1|TTHA1013-like| OP:NHOMO 10 OP:NHOMOORG 9 OP:PATTERN ----------------------------------------------11--11---------------- --------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------------11-----------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 73 STR:RPRED 68.2 SQ:SECSTR #########################HHHHHHHHH##TcEEEEccccccEEEEcTTcTTcEEEEccHHHHHHHHHHHHHHHHHHHHHTTccccccTTcccc####### DISOP:02AL 1-8| PSIPRED ccccccccccccccHHHHEEccccHHHHHHHHHHHHHHHHEEEcccccEEEEEcccccEEEccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEccccccc //