[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58004.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->64 PF10356 * DUF2034 0.0005 28.1 32/185  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58004.1 GT:GENE ABA58004.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1684872..1685102) GB:FROM 1684872 GB:TO 1685102 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58004.1 GB:DB_XREF GI:76883323 LENGTH 76 SQ:AASEQ MGQIAIYLDDKTEQPLKSAAAAAKMPVSLWVAALVKDKTRTQWPDSVRELAGAWSDFPEAETLRRETTADVPREPL GT:EXON 1|1-76:0| HM:PFM:NREP 1 HM:PFM:REP 32->64|PF10356|0.0005|28.1|32/185|DUF2034| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 19-22, 70-72, 75-76| PSIPRED cccEEEEEcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHHHcccccccc //