[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58011.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   55->89 PF07191 * DUF1407 0.0003 22.9 35/70  
:BLT:SWISS 1->67 MED16_XENLA 3e-04 27.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58011.1 GT:GENE ABA58011.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1690807..1691118 GB:FROM 1690807 GB:TO 1691118 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58011.1 GB:DB_XREF GI:76883330 LENGTH 103 SQ:AASEQ MTDSSFVLTKLHPPGEFALQWVPWAGHDLARKALDWVSPSTRITSPPTEGRSRSWQQGKYTANCWRNASHVGPCARCAVSLRLSACGHAQAGTLTGGSFNIHV GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 1->67|MED16_XENLA|3e-04|27.0|63/697| HM:PFM:NREP 1 HM:PFM:REP 55->89|PF07191|0.0003|22.9|35/70|DUF1407| OP:NHOMO 7 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------7----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 45-54| PSIPRED cccccEEEEEEcccccEEEEEEccccHHHHHHHHHHcccccEEccccccccccccccccEEEHHHcccccccHHHHHHHHHHHcccccccccEEcccEEEEEc //