[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58012.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58012.1 GT:GENE ABA58012.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1691230..1691658 GB:FROM 1691230 GB:TO 1691658 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58012.1 GB:DB_XREF GI:76883331 LENGTH 142 SQ:AASEQ MENNFLESGNFDKIHEVQYSIIKFFTLTAFWGTFSLLAILVAAGPDIPPFQTEIHYPMAEVQIEAPASVASFFQDGFSFGNGNCNKKSGCAGYHLQCNSHLCFLPECLVSHLHVAAIQWVFLPEAGPPEFQPLPLFKPPISA GT:EXON 1|1-142:0| TM:NTM 1 TM:REGION 21->43| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 6-7, 141-142| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccEEEEEEccHHHHHHHHHHHcccccccccccccccEEEEEcccEEEHHHHHHHHHHHHHHEEEEccccccccccccccccccccc //