[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58025.1
DDBJ      :             Outer membrane efflux protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
f.5.1
:486 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   96->485 1ek9A PDBj 3e-33 15.0 %
:RPS:SCOP  96->471 1wp1A  f.5.1.1 * 3e-29 17.6 %
:HMM:SCOP  2->472 1wp1A_ f.5.1.1 * 3.7e-53 22.6 %
:RPS:PFM   287->385 PF02321 * OEP 7e-04 31.3 %
:HMM:PFM   87->264 PF02321 * OEP 3.3e-17 24.9 177/188  
:HMM:PFM   286->437 PF02321 * OEP 6.9e-13 25.3 150/188  
:BLT:SWISS 98->462 CZCC_RALME 1e-14 23.2 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58025.1 GT:GENE ABA58025.1 GT:PRODUCT Outer membrane efflux protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1710395..1711855 GB:FROM 1710395 GB:TO 1711855 GB:DIRECTION + GB:PRODUCT Outer membrane efflux protein GB:PROTEIN_ID ABA58025.1 GB:DB_XREF GI:76883344 InterPro:IPR003423 LENGTH 486 SQ:AASEQ MKISHSPRACNRLPVLGIIALALLFIFTSCASHNLPSLGGQPGQGALFEPENGTIAASPEQTGEGKPLFGGVSSPEPVLTEGEALSLSKLEALARQHNPTLAQAKAQIQSEHAKALEAGLYPNPVIGYIGEQISVRGTVGEFQGGFIRQKIVTAGKLRLSREKYQARASAAELLALAQMYRVINAVRMQFYRTLGAERKLEVQQELLETAEDRQVTVQEMFNVGQANRADLHQTRVLRQAQLLNVQQAENDLAMERETLGAIIGLLQPLGEVTGKLEAPLRHLVWEEALERLLAESPELAAAHANLKADEIMVQREKVEPIPNLFIEGSAGRNFEASETVYGVRAFVEVPLFDWNQGTIRQAKADWRRQRNEVRRTELSLRQSLADWFRRFRTALQKVTEYQNVILPQSEQRYVTRLKSYRADRETWPGVLEAQQDFFHRGLIYIDQLVAWRQAQVAIDGFLLVGGLEPPAGVVPPGHIDSVPKPR GT:EXON 1|1-486:0| BL:SWS:NREP 1 BL:SWS:REP 98->462|CZCC_RALME|1e-14|23.2|354/418| TM:NTM 1 TM:REGION 10->32| SEG 18->27|iialallfif| SEG 83->94|ealslskleala| SEG 166->177|arasaaellala| RP:PDB:NREP 1 RP:PDB:REP 96->485|1ek9A|3e-33|15.0|386/423| RP:PFM:NREP 1 RP:PFM:REP 287->385|PF02321|7e-04|31.3|99/189|OEP| HM:PFM:NREP 2 HM:PFM:REP 87->264|PF02321|3.3e-17|24.9|177/188|OEP| HM:PFM:REP 286->437|PF02321|6.9e-13|25.3|150/188|OEP| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF02321|IPR003423| GO:PFM GO:0006810|"GO:transport"|PF02321|IPR003423| RP:SCP:NREP 1 RP:SCP:REP 96->471|1wp1A|3e-29|17.6|374/456|f.5.1.1| HM:SCP:REP 2->472|1wp1A_|3.7e-53|22.6|433/0|f.5.1.1|1/1|Outer membrane efflux proteins (OEP)| OP:NHOMO 67 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1----1------------------------------------------1-----------------------------------------------------------------1-1111------11-------11----12---1----111-----33--31----------111--1-1--------------2-21-1------1-1-------------------------------------------------------------2--------------------------------------------------------------------------------------------------------1--------------------------------12111111112112111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 389 STR:RPRED 80.0 SQ:SECSTR ###############################################################################################HHcHHHHHHHHHHHHHHHHHHHHHGGGccEEEEEEEcccccTTcEEEEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcTTTccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHGGGccEEEEEEEEEEETccccEEEEEEEEEEcccccTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH#HHHHTcccHHHHHHHHHTEEEEEEc# DISOP:02AL 1-7, 135-138, 477-486| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccEEEEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc //