[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58030.1
DDBJ      :             Protein-L-isoaspartate(D-aspartate) O-methyltransferase
Swiss-Prot:PIMT2_NITOC  RecName: Full=Protein-L-isoaspartate O-methyltransferase 2;         EC=2.1.1.77;AltName: Full=Protein-beta-aspartate methyltransferase 2;         Short=PIMT 2;AltName: Full=Protein L-isoaspartyl methyltransferase 2;AltName: Full=L-isoaspartyl protein carboxyl methyltransferase 2;

Homologs  Archaea  55/68 : Bacteria  447/915 : Eukaryota  109/199 : Viruses  0/175   --->[See Alignment]
c.66.1
:219 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->215 2yxeB PDBj 7e-37 44.9 %
:RPS:PDB   17->181 1cmvB PDBj 3e-16 10.9 %
:RPS:SCOP  3->215 1i1nA  c.66.1.7 * 2e-45 37.0 %
:HMM:SCOP  6->219 1jg1A_ c.66.1.7 * 1.3e-47 34.6 %
:RPS:PFM   28->211 PF01135 * PCMT 1e-42 51.4 %
:HMM:PFM   28->216 PF01135 * PCMT 9.1e-68 47.6 189/210  
:BLT:SWISS 1->219 PIMT2_NITOC e-116 100.0 %
:PROS 138->153|PS01279|PCMT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58030.1 GT:GENE ABA58030.1 GT:PRODUCT Protein-L-isoaspartate(D-aspartate) O-methyltransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1716252..1716911 GB:FROM 1716252 GB:TO 1716911 GB:DIRECTION + GB:PRODUCT Protein-L-isoaspartate(D-aspartate) O-methyltransferase GB:PROTEIN_ID ABA58030.1 GB:DB_XREF GI:76883349 InterPro:IPR000051 InterPro:IPR000682 LENGTH 219 SQ:AASEQ MKSHREMLRGIQREAGITQRWIGKESLDRRVMEAMKAVPRHEFVPDEQRPYAYDDAPLAIGCGQTISQPYIVALMTDLLDSTPDDIILEVGTGSGYQAAVLSRLVKKVYTIETIEELAQQAEARLERLGYSNVEVQTADGYFGWPEQAPFDGIMVTAAAPSIPKPLIDQLKPEARLVLPLGAGSPQELMVVTKKENDEIDIHRVLGVSFVPLTGKHEVP GT:EXON 1|1-219:0| SW:ID PIMT2_NITOC SW:DE RecName: Full=Protein-L-isoaspartate O-methyltransferase 2; EC=2.1.1.77;AltName: Full=Protein-beta-aspartate methyltransferase 2; Short=PIMT 2;AltName: Full=Protein L-isoaspartyl methyltransferase 2;AltName: Full=L-isoaspartyl protein carboxyl methyltransferase 2; SW:GN Name=pcm2; OrderedLocusNames=Noc_1546; SW:KW Complete proteome; Cytoplasm; Methyltransferase;S-adenosyl-L-methionine; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->219|PIMT2_NITOC|e-116|100.0|219/219| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 138->153|PS01279|PCMT|PDOC00985| SEG 115->128|eelaqqaearlerl| BL:PDB:NREP 1 BL:PDB:REP 29->215|2yxeB|7e-37|44.9|185/213| RP:PDB:NREP 1 RP:PDB:REP 17->181|1cmvB|3e-16|10.9|156/206| RP:PFM:NREP 1 RP:PFM:REP 28->211|PF01135|1e-42|51.4|183/205|PCMT| HM:PFM:NREP 1 HM:PFM:REP 28->216|PF01135|9.1e-68|47.6|189/210|PCMT| GO:PFM:NREP 2 GO:PFM GO:0004719|"GO:protein-L-isoaspartate (D-aspartate) O-methyltransferase activity"|PF01135|IPR000682| GO:PFM GO:0006464|"GO:protein modification process"|PF01135|IPR000682| RP:SCP:NREP 1 RP:SCP:REP 3->215|1i1nA|2e-45|37.0|200/225|c.66.1.7| HM:SCP:REP 6->219|1jg1A_|1.3e-47|34.6|214/0|c.66.1.7|1/1|S-adenosyl-L-methionine-dependent methyltransferases| OP:NHOMO 908 OP:NHOMOORG 611 OP:PATTERN 1111111111111112-11111121--2-211--11111111111-111121111111111---1--- -11-3------------------------------------264--1-------------411-23-1221-----------1-------------1--11111211-21--------------111-11111111---11---1--------11--------1--1---------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------111111132221213123213223222222222223-32133332242-222233434334222222222222122------------2222-----------------------------------2222222222222222333222222222432321122222211224222224222222111111122322212111211111111122211131211211-13-111111111111111111111112221111311111-1111111111111111121---3223------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---2-----111131111-------------------------1111111111111111111---------31111111111111122222222222222112---1111------------------------------------111-111111-1- ----11----1-----11--111-11-11-----1-11-1111-----------111------------------------------1-11111111-11--11-1-1-11442221-11-11-21-614B1-1-21--111-111111-1--1-222212-1111-112112211-11A1111-8122132-142331 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 100.0 SQ:SECSTR EEccTTTTGGGHHHHHcEEEETTEEEEEEEEEEEEEEcccEEEEEEEEccHHcccccEEETHHHHHHHHHHTcHHHHTccTccccHHHHHHHHHccEEEEEEcccccTTcccEEEccHHHHHTTcTTccHHHHHHHHHHHHccccccccHHHHHHHHHHHHTcTTHHHHHHHHHHHHTccGGGGTccEEEEEEEETTEEEEEEEEEccccccccEEcGc DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHcccHHHHHccccccccccccccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccEEEEEEEEcccEEEEEEEccEEEEEcccccccc //