[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58034.1
DDBJ      :             Protein of unknown function DUF785
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  85/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.50.1
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->133 2pmaB PDBj 3e-06 31.5 %
:RPS:SCOP  14->134 2pmaA1  b.50.1.3 * 3e-08 27.3 %
:RPS:PFM   14->147 PF05618 * DUF785 4e-27 46.2 %
:HMM:PFM   14->146 PF05618 * DUF785 5.5e-32 34.1 132/138  
:BLT:SWISS 12->164 RIMK_SHEPA 2e-31 42.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58034.1 GT:GENE ABA58034.1 GT:PRODUCT Protein of unknown function DUF785 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1720258..1720752) GB:FROM 1720258 GB:TO 1720752 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF785 GB:PROTEIN_ID ABA58034.1 GB:DB_XREF GI:76883353 InterPro:IPR008503 LENGTH 164 SQ:AASEQ MTTRQEPDKEDFFLGWREWVKLPELGVPGIKAKIDTGARTSVLHAFWLESFQEGHQNKIRFGLHPLQGRVDVELICVADILDKRVVTDSGGHRENRYVIETPVQIGNKCWPIEITLTNRDTMRFRMLLGRTALTAGKTRIVPDASYLAGPSLARRYAKRTKDKS GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 12->164|RIMK_SHEPA|2e-31|42.1|152/458| BL:PDB:NREP 1 BL:PDB:REP 30->133|2pmaB|3e-06|31.5|92/127| RP:PFM:NREP 1 RP:PFM:REP 14->147|PF05618|4e-27|46.2|132/137|DUF785| HM:PFM:NREP 1 HM:PFM:REP 14->146|PF05618|5.5e-32|34.1|132/138|DUF785| RP:SCP:NREP 1 RP:SCP:REP 14->134|2pmaA1|3e-08|27.3|110/126|b.50.1.3| OP:NHOMO 88 OP:NHOMOORG 86 OP:PATTERN -------------------------------------------------1------------------ ---------------------------------------------------1----1--------------------------------------------11-1--1---------------------------------------11-111----1-----1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------1-11------11-----------------------------------------------1-----------------------------------------------------------------------------1-1-----1-----------1---------------------------------------121-1111-----111----1-1--11---1111--------------------------------------------------------------------------------------------111-11-----1111-------------------------1111111111211111111---------1111-1111111111------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 58.5 SQ:SECSTR #############################EEEEEcTTcccEEEEcEEEEEEEETTEEEEEEEEEETTEEEEEEEEccccccccccE########EEEEEEEEEEETTEEEEEEEEEEccccccccEEEcHHHH############################### DISOP:02AL 1-7, 86-92, 150-164| PSIPRED cccccccccccEEEEEEEEEEEccccccEEEEEEEcccEEEEEEEEEcEEEEEcccEEEEEEEccccccccEEEEEEEEEEEEEEEEcccccccccEEEEEEEEEccEEEEEEEEEEccccccccEEEEcHHHHcccEEEcccccEEEcccccccccccccccc //