[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58046.1
DDBJ      :             Protein of unknown function DUF820
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:161 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  30->160 1wdjA  c.52.1.27 * 2e-14 17.6 %
:HMM:SCOP  4->132 1wdjA_ c.52.1.27 * 1e-12 27.0 %
:RPS:PFM   96->140 PF05685 * DUF820 2e-05 37.8 %
:HMM:PFM   40->140 PF05685 * DUF820 1.7e-13 26.7 101/111  
:HMM:PFM   4->63 PF05399 * EVI2A 0.00016 20.0 60/227  
:BLT:SWISS 54->118 THIC_METM7 5e-04 30.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58046.1 GT:GENE ABA58046.1 GT:PRODUCT Protein of unknown function DUF820 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1742495..1742980 GB:FROM 1742495 GB:TO 1742980 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF820 GB:PROTEIN_ID ABA58046.1 GB:DB_XREF GI:76883365 InterPro:IPR008538 LENGTH 161 SQ:AASEQ MVKMSWAEICQDPTLRDLPYKIQTDKWGNIVMSPATNEHGIYQAKIVALLSKLMNEGTIISECSVQTSEGIKVADVAWASEKFMQNNRGKSPFDEAPEICVEILSPSNTKMEMEEKKELYFARGAKEFWMCDKKGSISFYKNTGPLEHSNIIEGFPGTLSV GT:EXON 1|1-161:0| BL:SWS:NREP 1 BL:SWS:REP 54->118|THIC_METM7|5e-04|30.8|65/426| RP:PFM:NREP 1 RP:PFM:REP 96->140|PF05685|2e-05|37.8|45/112|DUF820| HM:PFM:NREP 2 HM:PFM:REP 40->140|PF05685|1.7e-13|26.7|101/111|DUF820| HM:PFM:REP 4->63|PF05399|0.00016|20.0|60/227|EVI2A| RP:SCP:NREP 1 RP:SCP:REP 30->160|1wdjA|2e-14|17.6|131/186|c.52.1.27| HM:SCP:REP 4->132|1wdjA_|1e-12|27.0|126/0|c.52.1.27|1/1|Restriction endonuclease-like| OP:NHOMO 8 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------5-----------------------------------------11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 160-161| PSIPRED cccccHHHHHcccccccccEEEEEccccEEEEcccccccHHHHHHHHHHHHHHccccEEEcccEEEccccccccEEEEEccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEccccccccEEccccccEEcc //