[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58047.1
DDBJ      :             Helix-turn-helix protein, CopG family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:80 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->44 2bj3D PDBj 2e-05 25.0 %
:RPS:SCOP  1->44 2bj1A1  a.43.1.3 * 2e-05 25.0 %
:HMM:SCOP  3->50 1q5vA1 a.43.1.3 * 7.3e-05 27.1 %
:HMM:PFM   8->44 PF01402 * RHH_1 6.9e-10 41.7 36/39  
:BLT:SWISS 1->57 Y1679_METJA 4e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58047.1 GT:GENE ABA58047.1 GT:PRODUCT Helix-turn-helix protein, CopG family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1743105..1743347 GB:FROM 1743105 GB:TO 1743347 GB:DIRECTION + GB:PRODUCT Helix-turn-helix protein, CopG family GB:PROTEIN_ID ABA58047.1 GB:DB_XREF GI:76883366 InterPro:IPR002145 LENGTH 80 SQ:AASEQ MSKAKIAITIDKPILARIDRLVAKQVFSSRSQAIEAAVEEKIERLAHGRLARECAKLDPAFEKALAEEGLSQELDEWPEY GT:EXON 1|1-80:0| BL:SWS:NREP 1 BL:SWS:REP 1->57|Y1679_METJA|4e-04|33.3|57/100| RP:PDB:NREP 1 RP:PDB:REP 5->44|2bj3D|2e-05|25.0|40/130| HM:PFM:NREP 1 HM:PFM:REP 8->44|PF01402|6.9e-10|41.7|36/39|RHH_1| RP:SCP:NREP 1 RP:SCP:REP 1->44|2bj1A1|2e-05|25.0|44/50|a.43.1.3| HM:SCP:REP 3->50|1q5vA1|7.3e-05|27.1|48/48|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 8 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------21---1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------11---------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 80 STR:RPRED 100.0 SQ:SECSTR cccccccccccHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHGGGccccEEEEEEEEEEETTcTTHHHHHHHHHHHT DISOP:02AL 1-4| PSIPRED cccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHcccc //