[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58056.1
DDBJ      :             Protein of unknown function DUF1130
Swiss-Prot:             

Homologs  Archaea  15/68 : Bacteria  79/915 : Eukaryota  7/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   13->138 PF04343 * DUF488 5e-08 35.4 %
:HMM:PFM   14->138 PF04343 * DUF488 4.1e-34 31.7 120/122  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58056.1 GT:GENE ABA58056.1 GT:PRODUCT Protein of unknown function DUF1130 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1751678..1752220 GB:FROM 1751678 GB:TO 1752220 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF1130 GB:PROTEIN_ID ABA58056.1 GB:DB_XREF GI:76883375 InterPro:IPR010556 LENGTH 180 SQ:AASEQ MLPFYTIGHSARTLDAFLDLLRAAQVTVVADIRSVPKSRTNPQYNKDILPNTLTAFQIGYEHIAELGGLRGKAKSVEPTVNSFWENRSFQNYADYALSVSFRAGLDRLIALGHARRCVMMCSEAVWWRCHRRIVADHLIARGESVIHLIGRDRAEPAKLTAGACVHKNGRVTYPAGSIEG GT:EXON 1|1-180:0| RP:PFM:NREP 1 RP:PFM:REP 13->138|PF04343|5e-08|35.4|113/113|DUF488| HM:PFM:NREP 1 HM:PFM:REP 14->138|PF04343|4.1e-34|31.7|120/122|DUF488| OP:NHOMO 106 OP:NHOMOORG 101 OP:PATTERN 11---1-1111111-1--1------------------------------11-1--------------- -21-1--1--1--1-------1-----------111--1111----1-1-----1-------1--11-1------------------------------11-----------------------------------------------------1---------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------1-------111----------------------------1-1--1----------212---------------------1--------------------------1------------------1---1------------------------------------11--122111-----1111------11-------------11-----11--1------------111------------1--------11----111111--------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1------------------------------------------1-----------------------------11111---------------------------------------------------------------1-- ---------------------------111111------------------------------------------------------------------------------------------------------------------------------------------------------1--------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 73-74, 175-180| PSIPRED ccEEEEEccccccHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHHHHcccEEEEcccccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccEEEEEccccccHHHHcccccEEccccEEEEccccccc //