[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58065.1
DDBJ      :             Flavodoxin reductases (ferredoxin-NADPH reductases) family 1
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  96/915 : Eukaryota  59/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1d.115.1
:221 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->197 1umkA PDBj 2e-11 32.3 %
:RPS:PDB   3->221 2bgjA PDBj 3e-28 17.9 %
:RPS:SCOP  1->154 1pvwA  d.115.1.2 * 7e-19 12.3 %
:HMM:SCOP  3->103 1umkA1 b.43.4.2 * 6.3e-15 31.0 %
:HMM:SCOP  94->223 1ep3B2 c.25.1.3 * 6.2e-26 27.0 %
:RPS:PFM   11->96 PF08022 * FAD_binding_8 1e-06 36.1 %
:RPS:PFM   107->203 PF00175 * NAD_binding_1 1e-06 31.6 %
:HMM:PFM   106->204 PF00175 * NAD_binding_1 2.1e-16 21.2 99/109  
:HMM:PFM   6->100 PF00970 * FAD_binding_6 2.7e-10 29.3 92/99  
:BLT:SWISS 15->197 MCR1_USTMA 7e-13 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58065.1 GT:GENE ABA58065.1 GT:PRODUCT Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1766751..1767416) GB:FROM 1766751 GB:TO 1767416 GB:DIRECTION - GB:PRODUCT Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 GB:PROTEIN_ID ABA58065.1 GB:DB_XREF GI:76883384 InterPro:IPR001221 InterPro:IPR001433 InterPro:IPR001709 InterPro:IPR001834 InterPro:IPR008333 LENGTH 221 SQ:AASEQ MTYTVTLLMAEFVTHDVKRFIVSRPPGFDYQPGQGVELAINQPEWKDQGRPFTPTSLGEDKVLEFTIKRYSDHHGVTEKLHTLLPGEELLMSDPFGTITYQGTGVFIAGGAGITPFMAIIRQLSHQDKLANHTLIFSNKTPADIICEKEFRHYFNEKCILTCTETSAPGYDDQLITGEFLQQNIADFNQQFYTCGPPQFTKDINNALVELGANPNALVFEK GT:EXON 1|1-221:0| BL:SWS:NREP 1 BL:SWS:REP 15->197|MCR1_USTMA|7e-13|31.3|179/350| BL:PDB:NREP 1 BL:PDB:REP 3->197|1umkA|2e-11|32.3|192/271| RP:PDB:NREP 1 RP:PDB:REP 3->221|2bgjA|3e-28|17.9|218/260| RP:PFM:NREP 2 RP:PFM:REP 11->96|PF08022|1e-06|36.1|83/101|FAD_binding_8| RP:PFM:REP 107->203|PF00175|1e-06|31.6|95/107|NAD_binding_1| HM:PFM:NREP 2 HM:PFM:REP 106->204|PF00175|2.1e-16|21.2|99/109|NAD_binding_1| HM:PFM:REP 6->100|PF00970|2.7e-10|29.3|92/99|FAD_binding_6| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00175|IPR001433| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00175|IPR001433| RP:SCP:NREP 1 RP:SCP:REP 1->154|1pvwA|7e-19|12.3|154/219|d.115.1.2| HM:SCP:REP 3->103|1umkA1|6.3e-15|31.0|100/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 94->223|1ep3B2|6.2e-26|27.0|122/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 210 OP:NHOMOORG 158 OP:PATTERN --------------------------------------------1----1-1---------------- -------------------------1----------2-1---1-----------------1---1--11-------------------------------1--121--2----------------------------------------------------------1-------------------------------------------------1---------------------------------------------------------------------------------------------------------------------1------1111-----------------1------------1----------1-3---------------------1--1--1----------1----------1-----------------1---1---------------------------------1---------1111111111111-11111-111---------1--11--11-----12-------------1---1------11------------------------------------------------------1-----------------------1-----1--1-------11----------------------------------1-111--11--11111111111111---------------------------------------111-------------------------------------------------------------1-22------------------------------------------------------------------------- --------21----11111111------1-------1----------1-11332-1-----------2-1---12-----1222-1---22-1---1-1-1-12-3--11-1---1------1----1-732----1--------1----------1--------------1------2F1-2----1------1221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 219 STR:RPRED 99.1 SQ:SECSTR ##TEEEEEEEEEEETTEEEEEEEccTTccccTTcEEEEEEEcTTccEEEEEEEccccTTccEEEEEEEccTTTcTTHHHHTTccTTcEEEEEEEEEccccccEEEEEEEGGGGHHHHHHTTcHHHHHHccEEEEEEEEccTTTTHHHHHHHHHHHHcHHHHHHTccccccHHHHHHHTHTcccccTTTEEEEEEEcHHHHHHHHHHHHHTTcccccccccc PSIPRED cEEEEEEEEEEEccccEEEEEEEcccccccccccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEEccccHHHHHHHHcccccEEEEEcccccEEEcccEEEEEEcccHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHcccccccEEEEEccHHHHHHHHHHHHHccccHHHEEEcc //