[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58070.1
DDBJ      :             Protein of unknown function DUF1469
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:151 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->139 PF07332 * DUF1469 1.1e-39 46.3 121/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58070.1 GT:GENE ABA58070.1 GT:PRODUCT Protein of unknown function DUF1469 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1771247..1771702 GB:FROM 1771247 GB:TO 1771702 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF1469 GB:PROTEIN_ID ABA58070.1 GB:DB_XREF GI:76883389 InterPro:IPR009937 LENGTH 151 SQ:AASEQ MSAYDPHTPPENRSIISLLSELTQEVTTLVRQELELAKAEASEKVSQVGSGIGAVVAGGAVAFGGFLVLLQALVYGLADILGEGNISPLWIASLIVGVVVLLIGYGLLKKGQSDLKAKHLVPRRTTRSLRKDKNMVKEEVRGNRSRYDETY GT:EXON 1|1-151:0| TM:NTM 2 TM:REGION 52->74| TM:REGION 87->108| SEG 33->44|elelakaeasek| SEG 48->65|vgsgigavvaggavafgg| SEG 94->111|livgvvvlligygllkkg| HM:PFM:NREP 1 HM:PFM:REP 15->139|PF07332|1.1e-39|46.3|121/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 42-48, 114-129, 131-133, 138-151| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccc //