[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58078.1
DDBJ      :             glutamate synthase (NADH) small subunit
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  632/915 : Eukaryota  180/199 : Viruses  0/175   --->[See Alignment]
a.1.2c.2.1c.3.1c.4.1
:480 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->468 2vdcG PDBj 2e-74 37.3 %
:RPS:PDB   35->311 2dw4A PDBj 7e-55 18.3 %
:RPS:PDB   315->479 1e6eA PDBj 2e-09 15.0 %
:RPS:SCOP  5->127 1nekB1  a.1.2.1 * 1e-17 13.3 %
:RPS:SCOP  131->169 1nytA1  c.2.1.7 * 3e-04 31.2 %
:RPS:SCOP  142->310 1gt8A4  c.4.1.1 * 2e-33 23.5 %
:RPS:SCOP  281->475 1fl2A1  c.3.1.5 * 1e-16 20.6 %
:HMM:SCOP  2->154 1h7wA1 a.1.2.2 * 3.5e-42 41.8 %
:HMM:SCOP  142->405 1lqtA2 c.4.1.1 * 2.7e-66 45.7 %
:HMM:SCOP  389->474 1djnA3 c.4.1.1 * 1.9e-12 38.7 %
:RPS:PFM   146->450 PF07992 * Pyr_redox_2 2e-23 40.4 %
:HMM:PFM   145->451 PF07992 * Pyr_redox_2 9.1e-34 35.7 185/202  
:BLT:SWISS 1->479 GLT1_SCHPO e-130 48.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58078.1 GT:GENE ABA58078.1 GT:PRODUCT glutamate synthase (NADH) small subunit GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1785513..1786955) GB:FROM 1785513 GB:TO 1786955 GB:DIRECTION - GB:PRODUCT glutamate synthase (NADH) small subunit GB:PROTEIN_ID ABA58078.1 GB:DB_XREF GI:76883397 InterPro:IPR000103 InterPro:IPR000205 InterPro:IPR000759 InterPro:IPR001100 InterPro:IPR001327 InterPro:IPR006005 LENGTH 480 SQ:AASEQ MGKPTGFMEIPRRDRTEAPVADRVQHFREFAIPLSEGEVREQGARCMDCGIPFCHPACPVNNIIPDWNDLVYRDDWRRALEVLQSTNNFPEFTGRICPAPCEAACTLNLTDEPVTIKTIECAIIDKGWQEGWIRPQIPTHKTGKRVAVVGSGPAGLACAQQLARVGHQVEVFEKNDRIGGLLRYGIPDFKMAKSLIDRRMAQMQAEGVAFHPNSHIGVNTPARSLLETFDALVLTGGSEDPRDLPIPGRELRGVHFAMDFLTQQNRRGAGISLPNQAPISAKDKHVIVIGGGDTGSDCIGTSFRQGALAVTQLEIMPQPPEKENKLLTWPNWPYKLRTSSSQAEGASRDWAVATKTFRGENGQVTALQLVRLKWHQNQQGHWKMEEVPNSEFELPADLVLLAMGFVHPVHAGLLEELGVALDGRGNVEADTERYQTSIPKVFAAGDMRRGQSLVVWAIREGRQAAQAVDEFLMGYSDLPR GT:EXON 1|1-480:0| BL:SWS:NREP 1 BL:SWS:REP 1->479|GLT1_SCHPO|e-130|48.5|478/2111| BL:PDB:NREP 1 BL:PDB:REP 25->468|2vdcG|2e-74|37.3|432/456| RP:PDB:NREP 2 RP:PDB:REP 35->311|2dw4A|7e-55|18.3|268/634| RP:PDB:REP 315->479|1e6eA|2e-09|15.0|160/457| RP:PFM:NREP 1 RP:PFM:REP 146->450|PF07992|2e-23|40.4|260/275|Pyr_redox_2| HM:PFM:NREP 1 HM:PFM:REP 145->451|PF07992|9.1e-34|35.7|185/202|Pyr_redox_2| RP:SCP:NREP 4 RP:SCP:REP 5->127|1nekB1|1e-17|13.3|120/132|a.1.2.1| RP:SCP:REP 131->169|1nytA1|3e-04|31.2|32/170|c.2.1.7| RP:SCP:REP 142->310|1gt8A4|2e-33|23.5|162/196|c.4.1.1| RP:SCP:REP 281->475|1fl2A1|1e-16|20.6|180/184|c.3.1.5| HM:SCP:REP 2->154|1h7wA1|3.5e-42|41.8|146/182|a.1.2.2|1/1|alpha-helical ferredoxin| HM:SCP:REP 142->405|1lqtA2|2.7e-66|45.7|232/0|c.4.1.1|1/1|Nucleotide-binding domain| HM:SCP:REP 389->474|1djnA3|1.9e-12|38.7|75/234|c.4.1.1|2/2|Nucleotide-binding domain| OP:NHOMO 1770 OP:NHOMOORG 840 OP:PATTERN --3-11----------11111--------1--------------111111111-3325552-111--- 1232111333321223211-1311231111113333498722122211222243423211112221333312222211212211111111222211-----1-1121111---------------45444434424-----333--1-1---1-----------1-------1-----1----22211111-11-------1-------211111---121-11111111122-11111111111111111112---11-------1111----1-111--------11----------------------------------122375555555657112212233221--5241863441111422211--1111113-----122231114322422222222222-11111111111-2112222222111111232222223323333333312211311-----------------------------122321111113333331222233222222123321211-111121211221421113211112----------411-9A432442364421324232353433412261--1-11111----------2212111322111221111222212522322222254---1232------213232-5555555555-555554555555555555322232112323333333333333313233333--122222222222---1-----111121121---1-1-----1---11111111111122222222122221111---------12335222224534411212112221111223111------------31--------------------------323222122111- 11--112-311112111121222222222122211112222222221111111121121111211111--1-11111-1111111122-11111111111111213-2225222212-11-122231314L3-3331--11-221-11-12112132212373432272343341-111R2-12153352242111212 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 478 STR:RPRED 99.6 SQ:SECSTR ##ccEEEEEcccccHHHHHHHHTTcEEEEccccccHHHHHHHHTTcTTcccHHHHHHcHHHHTccHHHHHHHHHcHHHHHHHHHHHcTTccccHcccHHHHHHHccTTGGGcHHHHHHHHHHHHHTTcccccccccccccccccEEEEEcccHHHHHHHHHHHHTTcEEEEEcccccccTTccEHHHHEEETTEEEEccccEEccccTcHHHHHHHHHTccEEEccccccEEcTTcccccHHHHHHHHHHHHHHHHHHHHHHHTccccEETTEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTcccccTHHHHHHHHHHcccEEcEEEEEEEcccEEEEEccTTcccEEEEEEEEcEEEEcccEEEccTTccGGGGTccccTTcccccccTTcccccTTEEEcGGGGcccccHHHHHHHHHHHHHHHHcccTTcccccc DISOP:02AL 1-2, 13-18, 479-480| PSIPRED cccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHccccccHHHHHHHHHHccccEEcccHHHHEEHHHHccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccHHHHHHHHHHHHHHcccEEEEcEEEEEEccHHHHHHHccEEEEEccccccccccccccccccEEEHHHHHHHHHHccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccEEEEEEcccEEEEEEEEEEEEEEcccccEEEEEccccEEEEEEEEEEEEEEEEcccccHHHHHccccccccccEEEccccEEEccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccc //