[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58083.1
DDBJ      :             NADPH-glutathione reductase
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  870/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.3.1d.87.1
:452 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->449 2rabB PDBj 4e-90 39.1 %
:RPS:PDB   5->446 1dncA PDBj 3e-78 38.3 %
:RPS:SCOP  6->370 1gosA1  c.3.1.2 * 2e-33 11.9 %
:HMM:SCOP  1->368 1cf3A1 c.3.1.2 * 5.8e-61 27.2 %
:HMM:SCOP  334->446 1onfA3 d.87.1.1 * 6.8e-35 40.7 %
:RPS:PFM   7->303 PF07992 * Pyr_redox_2 2e-23 33.7 %
:RPS:PFM   337->443 PF02852 * Pyr_redox_dim 3e-12 31.8 %
:HMM:PFM   7->305 PF07992 * Pyr_redox_2 1e-48 39.9 193/202  
:HMM:PFM   337->445 PF02852 * Pyr_redox_dim 1.6e-39 41.3 109/110  
:BLT:SWISS 3->448 GSHR_PSEAE e-130 52.0 %
:PROS 40->50|PS00076|PYRIDINE_REDOX_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58083.1 GT:GENE ABA58083.1 GT:PRODUCT NADPH-glutathione reductase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1795257..1796615) GB:FROM 1795257 GB:TO 1796615 GB:DIRECTION - GB:PRODUCT NADPH-glutathione reductase GB:PROTEIN_ID ABA58083.1 GB:DB_XREF GI:76883402 InterPro:IPR000103 InterPro:IPR000815 InterPro:IPR001100 InterPro:IPR001327 InterPro:IPR004099 InterPro:IPR006076 InterPro:IPR006324 LENGTH 452 SQ:AASEQ MTSYDFDLFVIGAGSGGVRSARMAAGFGARVAIAEERYLGGTCVNVGCIPKKLFLYAAHFSEDFEDATGFGWTVGQRQFDWSTLIQNKNTEIQRLNKIYENLLGKAGVTLVSGRARLETPHTVSVNNHCYTAERILVATGGWPVVPEFPGREHVITSNEAFFLDKLPERVAIVGGGYIAVEFASIFNGLGSNTTLLYRGPLFLRGFDDDLRQNLAQEMSKRGVKLCFNTQVAAVEKGGQGFTIKCHDGKTLEVDALMYATGRAPNTLGLGLEDLGVELSWNGAVVVNDHYQSSIPSIYGIGDVTHRLNLTPVALAEAMVLTRILYGGGYSRLDYSNIPACIFSHPNVATVGLTEEQAGEHCGEINVYRSSFRPLKHTLSGRDERTMVKLIVEKTTDRVVGAHMLGPDAGEIIQGIAIAIKAGATKSTFDSTLGIHPTAAEEFVTLRQPVTGL GT:EXON 1|1-452:0| BL:SWS:NREP 1 BL:SWS:REP 3->448|GSHR_PSEAE|e-130|52.0|446/451| PROS 40->50|PS00076|PYRIDINE_REDOX_1|PDOC00073| SEG 267->278|lglgledlgvel| SEG 408->423|ageiiqgiaiaikaga| BL:PDB:NREP 1 BL:PDB:REP 6->449|2rabB|4e-90|39.1|442/452| RP:PDB:NREP 1 RP:PDB:REP 5->446|1dncA|3e-78|38.3|441/460| RP:PFM:NREP 2 RP:PFM:REP 7->303|PF07992|2e-23|33.7|267/275|Pyr_redox_2| RP:PFM:REP 337->443|PF02852|3e-12|31.8|107/110|Pyr_redox_dim| HM:PFM:NREP 2 HM:PFM:REP 7->305|PF07992|1e-48|39.9|193/202|Pyr_redox_2| HM:PFM:REP 337->445|PF02852|1.6e-39|41.3|109/110|Pyr_redox_dim| GO:PFM:NREP 5 GO:PFM GO:0005737|"GO:cytoplasm"|PF02852|IPR004099| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF02852|IPR004099| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF02852|IPR004099| GO:PFM GO:0050660|"GO:FAD binding"|PF02852|IPR004099| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02852|IPR004099| RP:SCP:NREP 1 RP:SCP:REP 6->370|1gosA1|2e-33|11.9|361/385|c.3.1.2| HM:SCP:REP 1->368|1cf3A1|5.8e-61|27.2|346/0|c.3.1.2|1/1|FAD/NAD(P)-binding domain| HM:SCP:REP 334->446|1onfA3|6.8e-35|40.7|113/119|d.87.1.1|1/1|FAD/NAD-linked reductases, dimerisation (C-terminal) domain| OP:NHOMO 4220 OP:NHOMOORG 1122 OP:PATTERN 221-117455566666243231114112126112121--1---22121113321111-221344---- 4444743344533384555-7711865555535444378634344535455256A4443344B464554321222333--123131114441-32212222327333232111111111111113131222112123331211232344333412332222222224547422222222222242244221153555555453556545563353555242547754444456444444343344433396654261551222289443525777256564454445544444334444433333333333335654445554224-144444433432522112252--23-1--41-51334124342124215633433333355343343333344444444445-4454654667434554659666773955555444445653333333353324343223222222211222222222222222221535723535667776864444553555553456637573245434356635452364311133333333346353323412332333222132424433133334412111-------------------212673437854545622222242422322223441-1764511111153345335556566655-55555665555654545555554433345555655554755564444444531455555555555113311111445425755222222222222222544453455433566755554555644335444453444545644444636444334334333222222334433331-------31322212-2-32211222132133---2122321222541 4411224-D5512222222122222222222222212222222221333334332223222222222222222234323422222222-53222222222222425-3B584744565555565CB4E4N*9-B7K3354A4565456565359587566BF35422533755654654*44455667B2948987679 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 451 STR:RPRED 99.8 SQ:SECSTR HcEEEccEEEEcccHHHHHHHHHHHHTTccEEEEEcccTTHHHHHTcHHHHHHHHHHHHHHHHHHHTGGGTcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHTTcEEEEcccEEcccccEEETTEEEEccEEEEcccEEEccccTTTGGGcccHHHHTTccccccEEEEEcccHHHHHHHHHHHHTTcEEEEEcccccccTTccHHHHHHHHHHHHHTTcEEETTEEEEEEEEccccEEEEcEEEEEEEEcEEEEcccEEEccTTccGGGGTccccTTccccccTTcccccTTEEEccGGGcccccHHHHHHHHHHHHHHHcccTTcccccccccEEEcccccEEEEEccHHHHHHHHcGGGEEEEEEccGGGGGccccccEEEEEEEETTTTEEEEEEEEcTTHHHHHHHHHHHHHTTccHHHHHTccccccccGGGGGcccHcTTT# DISOP:02AL 452-453| PSIPRED cccccccEEEEcccHHHHHHHHHHHHcccEEEEEEccccccEEEEEccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEccEEEEEEEEEEEcccccccccccccccEEEcHHHHHHHHcccEEEEEcccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEccccEEEEEEEEEEcccccccccccHHHcccEEcccccEEEccEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHHccccccccccccccEEEEccccEEEEEccHHHHHHccccEEEEEEEEcccccEEccccccEEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHcccc //