[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58087.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:214 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   154->189 2e1pA PDBj 7e-04 19.4 %
:BLT:SWISS 143->192 BPRX_DICNO 2e-04 38.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58087.1 GT:GENE ABA58087.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1802309..1802953 GB:FROM 1802309 GB:TO 1802953 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58087.1 GB:DB_XREF GI:76883406 LENGTH 214 SQ:AASEQ MSRVRVYLLVLIFFGFALSAAAGENFEKQRSPALENSALFPLLEGLLREKSGLPLNSKQHSSPAKEAMLKSESVASRLEPAPPPEVIVEGIIVRFQSPDIQALAQANLPPPEAVIAELEAALGEELVFHGAMVNEAHVFRFLTPKESRAVTPLLQRAENLPSIEWIEADTRVEPQSSSNDPFFSSQWNLMGEKEGFAGGIEAALYGKPGRLRLS GT:EXON 1|1-214:0| BL:SWS:NREP 1 BL:SWS:REP 143->192|BPRX_DICNO|2e-04|38.3|47/100| TM:NTM 1 TM:REGION 6->26| SEG 108->126|lpppeaviaeleaalgeel| RP:PDB:NREP 1 RP:PDB:REP 154->189|2e1pA|7e-04|19.4|36/395| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 36 STR:RPRED 16.8 SQ:SECSTR #########################################################################################################################################################HHHHHTcTTEEEEEEcEETTcccccccccccccHHH######################### DISOP:02AL 1-2, 24-25, 27-32, 52-76, 176-180, 213-214| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccHHHccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccEEcccEEEEEEccccHHHcccccccHHHHHHHHHHHHccccccccccccccEEEEEEccHHHHHHHHHHHHHHHcccEEEEccHHccccccccccccccccccccccccccccccEEEEEcccccEEcc //