[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58110.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:179 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58110.1 GT:GENE ABA58110.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1829915..1830454 GB:FROM 1829915 GB:TO 1830454 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58110.1 GB:DB_XREF GI:76883429 LENGTH 179 SQ:AASEQ MFSNVINFSKTLYAIFQLEAGPQKLPSSLPLLGGSLILYVLCRLWVGTFDYSAGAAGFLGVFDAVLLVLMASVPLLLLKRGDRIVQTVTALVCVGIAVSLADLFLLFLLSDLPLPVSEERMDGLLSFLTFPVLLWRLLMNTTLLRYALSWGFMSAFALAVGHLAVVGFLGGRLASSLMG GT:EXON 1|1-179:0| TM:NTM 5 TM:REGION 26->48| TM:REGION 56->78| TM:REGION 89->111| TM:REGION 119->141| TM:REGION 153->175| SEG 21->38|gpqklpsslpllggslil| SEG 65->78|vllvlmasvpllll| SEG 97->116|avsladlfllfllsdlplpv| SEG 133->145|llwrllmnttllr| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHcccHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //