[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58123.1
DDBJ      :             Conserved hypothetical protein 374
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:334 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   19->310 PF03706 * UPF0104 2.7e-30 24.5 282/294  
:BLT:SWISS 37->145 Y2231_ARCFU 8e-06 26.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58123.1 GT:GENE ABA58123.1 GT:PRODUCT Conserved hypothetical protein 374 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1845650..1846654 GB:FROM 1845650 GB:TO 1846654 GB:DIRECTION + GB:PRODUCT Conserved hypothetical protein 374 GB:PROTEIN_ID ABA58123.1 GB:DB_XREF GI:76883442 InterPro:IPR005242 LENGTH 334 SQ:AASEQ MRRYWILALLAMGLGLAIPFSYGGLAVFERLGQVPLWLPLLTLAMIVLGWNFNAAKLRILVSAVDTKLSHRSALGTVMAWEFAFSATPAGSGGIVSYIYLLNRYGVKTAHAAAIFTMEMGIDLLFFITASIIVVIKLATNVAYDIHLGFVLVVVLLTGGMGVMWILARQYQKLLRVFGYLLKLFKVSTPRRKRAARWMLRLRHGLMLLLGLPRRHLYAAYLFCVAHWLLRFSVLYVLLLGLGENVPWPYLFITQVLILTLGHFTFLPGGSGGVELGFGVMLGPFLDSATLATALVLWRFATFYWYLIAGAPVFVAVAGPVIFQTLAQATTKKSL GT:EXON 1|1-334:0| BL:SWS:NREP 1 BL:SWS:REP 37->145|Y2231_ARCFU|8e-06|26.6|109/100| TM:NTM 8 TM:REGION 4->26| TM:REGION 35->56| TM:REGION 79->101| TM:REGION 111->133| TM:REGION 146->168| TM:REGION 217->239| TM:REGION 274->296| TM:REGION 305->327| SEG 7->17|lallamglgla| SEG 147->162|lgfvlvvvlltggmgv| SEG 198->216|mlrlrhglmlllglprrhl| SEG 228->242|llrfsvlyvlllglg| SEG 268->278|ggsggvelgfg| SEG 307->322|iagapvfvavagpvif| HM:PFM:NREP 1 HM:PFM:REP 19->310|PF03706|2.7e-30|24.5|282/294|UPF0104| OP:NHOMO 13 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------1--------------------------1-1111--1--11111---------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 330-334| PSIPRED cHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccc //