[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58134.1
DDBJ      :             aminodeoxychorismate lyase apoprotein
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  478/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
e.17.1
:273 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->252 1i2kA PDBj 4e-48 40.1 %
:RPS:PDB   2->258 1daaA PDBj 1e-52 22.9 %
:RPS:SCOP  1->258 1et0A  e.17.1.1 * 6e-60 40.7 %
:HMM:SCOP  1->266 1et0A_ e.17.1.1 * 3e-70 35.0 %
:RPS:PFM   42->244 PF01063 * Aminotran_4 1e-19 33.0 %
:HMM:PFM   41->263 PF01063 * Aminotran_4 2.4e-46 34.5 220/232  
:BLT:SWISS 1->252 PABC_ECOLI 1e-47 40.1 %
:PROS 173->202|PS00770|AA_TRANSFER_CLASS_4
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58134.1 GT:GENE ABA58134.1 GT:PRODUCT aminodeoxychorismate lyase apoprotein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1855858..1856679) GB:FROM 1855858 GB:TO 1856679 GB:DIRECTION - GB:PRODUCT aminodeoxychorismate lyase apoprotein GB:PROTEIN_ID ABA58134.1 GB:DB_XREF GI:76883453 InterPro:IPR001544 LENGTH 273 SQ:AASEQ MILVNGKVASSIEVADRGLQYGDGLFETIAIRDERAILYLSHLKRLEDGCRRLSIPLIARRILDEEIFKLCQGVSRGVLKIVVTRGSGGRGYQPPSQPQPTRILSLHPWPNYPSIFMEYGITLRVCRTSLGYNPCLAGIKHLNRLEQVLARSEWENPMIPEGLMLDSQGHVVEGTMSNLFIVQNGLLETPDLSGCGVAGVMREFILKQAFNSGLKTIVRPLILADLRSAEEIFMCNSLIGIWPVRRVGETQYPLGPLTQHLQHLIQIQLLHSN GT:EXON 1|1-273:0| BL:SWS:NREP 1 BL:SWS:REP 1->252|PABC_ECOLI|1e-47|40.1|252/269| PROS 173->202|PS00770|AA_TRANSFER_CLASS_4|PDOC00618| SEG 259->271|qhlqhliqiqllh| BL:PDB:NREP 1 BL:PDB:REP 1->252|1i2kA|4e-48|40.1|252/269| RP:PDB:NREP 1 RP:PDB:REP 2->258|1daaA|1e-52|22.9|253/277| RP:PFM:NREP 1 RP:PFM:REP 42->244|PF01063|1e-19|33.0|197/220|Aminotran_4| HM:PFM:NREP 1 HM:PFM:REP 41->263|PF01063|2.4e-46|34.5|220/232|Aminotran_4| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF01063|IPR001544| GO:PFM GO:0008152|"GO:metabolic process"|PF01063|IPR001544| RP:SCP:NREP 1 RP:SCP:REP 1->258|1et0A|6e-60|40.7|246/254|e.17.1.1| HM:SCP:REP 1->266|1et0A_|3e-70|35.0|266/266|e.17.1.1|1/1|D-aminoacid aminotransferase-like PLP-dependent enzymes| OP:NHOMO 875 OP:NHOMOORG 522 OP:PATTERN ------------------11---11---12111111111111111111111111-------------1 1-1-1-------------------------------11-------1-1---1---------11-1--1111----1----1-1--111------------111-21--11--------------1111111111112221111-2-3112111112211-2121121----11-111111122-----11-22255555555455555522332255533311--11111111-----1---------1---1------------------1-------111-----------------------------------------11--1--------------211------1--12332-1111222111-1--11---1-----22---111-1-11----------2-------1-223----111-1--1-12-321-143341-111111111111-1122------------------------------1---1111122222223222222213333231232-1211--22211111-111111332322-------222--3--1-12222121121-------1-2222-2-1--111-----1---------1----222231132111111111112111121221221--3333------22442222222222222-2222222222222222222222222222222222222222222222222222-22222222222222-211111112133311---------------22222222222222221111211112111---------212222222222222--------------221-111111-------------------------------------1---1-1-1211 ---------------------1---1----------------------11-11-------------------------------------------------------------------------------------------------------------12---------1---1-------1--1----1----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 94.5 SQ:SECSTR cEEETTEEEEcccTTcHHHHHccEEEEEEEEETTEEccHHHHHHHHHHHHHHTTcccccHHHHHHHHHHHHHTcccEEEEEEEEcccccccccccccccccEEEEEEEEccccHHHHHHcEEEEEEEcccccccccTTccccccHHHHHHHHHHHHTTccEEEEEETTTEEEEETTcEEEEEETTEEEEccccTTccccHHHHHHHHHHHHTTccEEcccccHHHHHTccEEEEEETTTEEEEEEEETTEEcTccHHH############### PSIPRED cEEEccEEEEEcccccHHHHHccEEEEEEEEEccEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEEEEEcccccccccccccccEEEEEEEEcccccHHHHcccEEEEEEccccccccccccccccccHHHHHHHHHHHHccccEEEEEcccccEEEcccEEEEEEEccEEEEccccccccccHHHHHHHHHHHHccccEEEEEccHHHHHcccEEEEEcccEEEEEEEEEccEEccccHHHHHHHHHHHHHHHccc //