[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58137.1
DDBJ      :             3-oxoacyl-[acyl-carrier-protein] reductase
Swiss-Prot:             

Homologs  Archaea  56/68 : Bacteria  879/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:247 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->246 1q7bA PDBj 2e-79 61.7 %
:RPS:PDB   2->246 1dohB PDBj 1e-42 22.1 %
:RPS:SCOP  8->246 1pwxA  c.2.1.2 * 4e-47 21.0 %
:HMM:SCOP  1->243 1zemA1 c.2.1.2 * 8.6e-87 46.5 %
:RPS:PFM   6->173 PF00106 * adh_short 5e-23 41.7 %
:HMM:PFM   6->172 PF00106 * adh_short 3.6e-39 32.7 162/167  
:BLT:SWISS 1->246 FABG_VIBHA 1e-81 63.4 %
:PROS 141->169|PS00061|ADH_SHORT
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58137.1 GT:GENE ABA58137.1 GT:PRODUCT 3-oxoacyl-[acyl-carrier-protein] reductase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1858417..1859160) GB:FROM 1858417 GB:TO 1859160 GB:DIRECTION - GB:PRODUCT 3-oxoacyl-[acyl-carrier-protein] reductase GB:PROTEIN_ID ABA58137.1 GB:DB_XREF GI:76883456 InterPro:IPR002198 InterPro:IPR002347 InterPro:IPR011284 LENGTH 247 SQ:AASEQ MRLEGKVALITGASRGIGRAIAEGLALQGATVVGTATSKEGTEGISAFLAEREWPGMGIILDVSDPTSIDSALAVISDQLGVPAILVNNAGITRDNLLMRMKDEEWETILNINLTAIYRLSKGCLRGMMKTRWGRIINITSVTGVMGNAGQTNYAAAKAGMIGFTKALAREVGTRGVTVNAVAPGFIDTDMTRDLADTRREMLLAQIPLNRLGKAQEVAAAVAFLASLEASYITGETLHVNGGLYMA GT:EXON 1|1-247:0| BL:SWS:NREP 1 BL:SWS:REP 1->246|FABG_VIBHA|1e-81|63.4|243/244| PROS 141->169|PS00061|ADH_SHORT|PDOC00060| SEG 215->231|aqevaaavaflasleas| BL:PDB:NREP 1 BL:PDB:REP 4->246|1q7bA|2e-79|61.7|240/243| RP:PDB:NREP 1 RP:PDB:REP 2->246|1dohB|1e-42|22.1|244/271| RP:PFM:NREP 1 RP:PFM:REP 6->173|PF00106|5e-23|41.7|168/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 6->172|PF00106|3.6e-39|32.7|162/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 8->246|1pwxA|4e-47|21.0|233/252|c.2.1.2| HM:SCP:REP 1->243|1zemA1|8.6e-87|46.5|243/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 19371 OP:NHOMOORG 1130 OP:PATTERN 22112468B9B9A99529233211A559577B22---------21154--722-24112133853145 JLd5t41588G785v**TU-T*55u*TSTTTl****x***6xH*YLHD6EC3WMQC5H11MMd7QNhjmYF211122322B8X12433879728331--B7a6HG*EeBN111111111111115975BC757AA7HKKMM222NCIGJKBA87633433763385GMHdA223234334233JDAAB781G9TIIJIJNIKHJKJMNJSIRRIOJIKBHIPNLE888887Lo966666546666665BAAAD93B2BD26232CF55AA8986BA886778776745545554555555577677787777743333233384359E5554444547957728A77331188322A6123325333356533F2IwOOZ22222SF*rq89DgYcbULMMLKKMKMMX-NRUNLvLTd*j2*rrRshv***yybgKSIQQYRKOSLLPCCCCCCCCTXXG8CGB22222222111222331221222121111AIu*SAMndTl*u****UTTUQpp**YWXXCX*c*d**k58UVRMEOLLeNkSxrAGF5C8EE6233222234BOJAAT7G412212433426985F44949DECVZ34243323322422411211116253487CCAAHIFCPE79787A7FDB998D8BC98D1-33359111111EGJM7NADFFEDDDDDD-FDDEFCDEFEFCFEDDEDDRYTLC9ABC8AABACBCBBABABBXCEACCAC51A99999999999111A57545EFDE4IONK111928111112463RSSWTFM7EAO9ZaTWOWcjPRQYTNXTT8343343333566H76776CB69AMOPKNJIDDD96762246HHA9DD--------1-4----2---3-1------3-------54421666763G3 1211OJJ-61317CKlvnfreod*w*zQRDIHJNMMLWORLQSIHHeZftl***WgbRMPNNFAN7846D76KBJ47557BFEEFI6C-SwRvMeKJEKCIAHSKK-MUA*s*cdoVFBIEOdGpdBhEx*e-ZXnKNIFhGPiTCOGFGa6AdLbRjtu*cI*ieRaTl*Pblh5GC5*535AXHah*kqPKFiQUPC ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 247 STR:RPRED 100.0 SQ:SECSTR TccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTccEEEEEcTTcHHHHHHHHHHHHHHHccccEEEEcccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHccTTcEEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHHHHHHHHHHHccTTcccccHHHHHHHHHHHHcGGGTTccccEEEEccccccc DISOP:02AL 246-248| PSIPRED ccccccEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccccc //