[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58141.1
DDBJ      :             LSU ribosomal protein L32P
Swiss-Prot:RL32_NITOC   RecName: Full=50S ribosomal protein L32;

Homologs  Archaea  0/68 : Bacteria  320/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
g.41.8
:65 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->54 1vs60 PDBj 7e-17 71.7 %
:RPS:PDB   2->50 3d5b5 PDBj 6e-10 24.5 %
:RPS:SCOP  2->54 1vs601  g.41.8.5 * 2e-16 71.7 %
:HMM:SCOP  2->54 2i2t01 g.41.8.5 * 5.1e-18 43.4 %
:RPS:PFM   2->53 PF01783 * Ribosomal_L32p 2e-04 42.3 %
:HMM:PFM   2->54 PF01783 * Ribosomal_L32p 1.1e-20 43.4 53/56  
:BLT:SWISS 1->65 RL32_NITOC 2e-35 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58141.1 GT:GENE ABA58141.1 GT:PRODUCT LSU ribosomal protein L32P GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1862111..1862308) GB:FROM 1862111 GB:TO 1862308 GB:DIRECTION - GB:PRODUCT LSU ribosomal protein L32P GB:PROTEIN_ID ABA58141.1 GB:DB_XREF GI:76883460 InterPro:IPR002677 InterPro:IPR005718 LENGTH 65 SQ:AASEQ MAVQQNKKTPSKRGMRRAHDVLKKPTFSVDFSSGETHRRHHVTPDGYYRGKKVIFSKDENEEENE GT:EXON 1|1-65:0| SW:ID RL32_NITOC SW:DE RecName: Full=50S ribosomal protein L32; SW:GN Name=rpmF; OrderedLocusNames=Noc_1669; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->65|RL32_NITOC|2e-35|100.0|65/65| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 2->54|1vs60|7e-17|71.7|53/56| RP:PDB:NREP 1 RP:PDB:REP 2->50|3d5b5|6e-10|24.5|49/52| RP:PFM:NREP 1 RP:PFM:REP 2->53|PF01783|2e-04|42.3|52/56|Ribosomal_L32p| HM:PFM:NREP 1 HM:PFM:REP 2->54|PF01783|1.1e-20|43.4|53/56|Ribosomal_L32p| GO:PFM:NREP 3 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF01783|IPR002677| GO:PFM GO:0006412|"GO:translation"|PF01783|IPR002677| GO:PFM GO:0015934|"GO:large ribosomal subunit"|PF01783|IPR002677| RP:SCP:NREP 1 RP:SCP:REP 2->54|1vs601|2e-16|71.7|53/56|g.41.8.5| HM:SCP:REP 2->54|2i2t01|5.1e-18|43.4|53/0|g.41.8.5|1/1|Zn-binding ribosomal proteins| OP:NHOMO 323 OP:NHOMOORG 322 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--11-1111111111111111111-11111111111-111111-11111111-1----------------------------------11-------------------------11111111211111111111111111111111111111111111111111111111111111111111111-----------------------------------------------------------111111-111111111111111111111-11-1111111-111-111111111-111--1-111111111111111111111111111-111--1----11111111111-1111111111111111111111111111111111111111111111111111111---1111111111111111111---------1---11111111-111111111111111111--------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 81.5 SQ:SECSTR #ccccccccHHHHHHHTTTTcccccccEEccccccEEccccccTTTcccccccc########### DISOP:02AL 1-19, 57-65| PSIPRED cccccccccHHHHccccccHHcccccEEEccccccccccEEEcccccccHHEEcccccccccccc //