[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58145.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.52
:168 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  90->164 1utaA  d.58.52.1 * 4e-09 22.5 %
:HMM:SCOP  87->168 1utaA_ d.58.52.1 * 4.1e-12 28.6 %
:RPS:PFM   92->138 PF05036 * SPOR 1e-08 40.4 %
:HMM:PFM   89->163 PF05036 * SPOR 3.2e-14 29.7 74/76  
:HMM:PFM   43->116 PF11670 * MSP1a 0.00098 29.7 74/148  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58145.1 GT:GENE ABA58145.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1864987..1865493) GB:FROM 1864987 GB:TO 1865493 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA58145.1 GB:DB_XREF GI:76883464 InterPro:IPR007730 LENGTH 168 SQ:AASEQ MLNKNLKQRLIGASVLIGVGIIIIPVLLGESTEILPEYKDSEGGDNLSSELEKSTFTSTVKKLPTQDGKKLPSVVSAKEEQSSASSSKETKWFIQIGSFGHRENALRIHRDVTSFGYKAFIETAKKGGETIYKVRVGPEKDGIRAKEIKQELERRLQTKAFVISPSDG GT:EXON 1|1-168:0| TM:NTM 1 TM:REGION 10->32| SEG 10->29|ligasvligvgiiiipvllg| SEG 73->88|svvsakeeqssasssk| RP:PFM:NREP 1 RP:PFM:REP 92->138|PF05036|1e-08|40.4|47/76|SPOR| HM:PFM:NREP 2 HM:PFM:REP 89->163|PF05036|3.2e-14|29.7|74/76|SPOR| HM:PFM:REP 43->116|PF11670|0.00098|29.7|74/148|MSP1a| RP:SCP:NREP 1 RP:SCP:REP 90->164|1utaA|4e-09|22.5|71/77|d.58.52.1| HM:SCP:REP 87->168|1utaA_|4.1e-12|28.6|77/0|d.58.52.1|1/1|Sporulation related repeat| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 38-89, 145-152, 167-168| PSIPRED cccHHHHHHHHHHHHHHHHHHEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHHcccccccEEEEccccEEEEEEEcccccHHHHHHHHHHHHHHccccEEEEccccc //