[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58150.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:RPS:PDB   89->115 3dy5A PDBj 8e-04 22.2 %
:BLT:SWISS 40->81 AMER1_PONAB 5e-04 34.1 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58150.1 GT:GENE ABA58150.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1871791..1872201) GB:FROM 1871791 GB:TO 1872201 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58150.1 GB:DB_XREF GI:76883469 LENGTH 136 SQ:AASEQ MKVLFLGIGLFAGCVSSGFTKDRLITLEDAIQSYASGIRWQHYEILDTLVRPRNGQPKPVSREFLNSARITRYEVRRRQLSEDGLTAKVTIKFNYYYPDDNVIRTLNDQQGWWYEEESQRWFLEKLPNFTQASPSL GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 40->81|AMER1_PONAB|5e-04|34.1|41/333| TM:NTM 1 TM:REGION 1->21| RP:PDB:NREP 1 RP:PDB:REP 89->115|3dy5A|8e-04|22.2|27/1002| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 134-136| PSIPRED cEEEEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccHHHHHHEEEEccccccHHHHHHHHHcEEEcEEEEEEEccccccEEEEEEEEEEEEcccHHHHHHHHEEEEEEccccEEEEEEcccHHccccccc //