[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58163.1
DDBJ      :             Protein of unknown function UPF0047
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  343/915 : Eukaryota  104/199 : Viruses  0/175   --->[See Alignment]
d.273.1
:138 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   17->138 1vphF PDBj 6e-13 33.1 %
:RPS:PDB   1->135 2cu5A PDBj 9e-33 35.9 %
:RPS:SCOP  2->138 1vmjA  d.273.1.1 * 3e-35 25.9 %
:HMM:SCOP  1->138 1vmfA_ d.273.1.1 * 3e-43 44.4 %
:RPS:PFM   17->135 PF01894 * UPF0047 3e-35 53.8 %
:HMM:PFM   18->135 PF01894 * UPF0047 1.2e-42 44.0 116/118  
:BLT:SWISS 4->138 Y1880_SYNY3 2e-34 46.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58163.1 GT:GENE ABA58163.1 GT:PRODUCT Protein of unknown function UPF0047 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1891707..1892123) GB:FROM 1891707 GB:TO 1892123 GB:DIRECTION - GB:PRODUCT Protein of unknown function UPF0047 GB:PROTEIN_ID ABA58163.1 GB:DB_XREF GI:76883482 InterPro:IPR001602 LENGTH 138 SQ:AASEQ MVVQERLEVTTSGRGTVEITDQLQRIAAGSDIKTGLCHIFLHHTSASLMLCENADPAVRYDLEAYFSRLVPDGDPLFTHQQEGADDMAAHVRTVLTHSELNLPVTQGRCALGTWQGVYLWEHRFSGYRRQVTVTVYGE GT:EXON 1|1-138:0| BL:SWS:NREP 1 BL:SWS:REP 4->138|Y1880_SYNY3|2e-34|46.7|135/147| BL:PDB:NREP 1 BL:PDB:REP 17->138|1vphF|6e-13|33.1|118/143| RP:PDB:NREP 1 RP:PDB:REP 1->135|2cu5A|9e-33|35.9|128/129| RP:PFM:NREP 1 RP:PFM:REP 17->135|PF01894|3e-35|53.8|119/120|UPF0047| HM:PFM:NREP 1 HM:PFM:REP 18->135|PF01894|1.2e-42|44.0|116/118|UPF0047| RP:SCP:NREP 1 RP:SCP:REP 2->138|1vmjA|3e-35|25.9|135/139|d.273.1.1| HM:SCP:REP 1->138|1vmfA_|3e-43|44.4|135/0|d.273.1.1|1/1|YjbQ-like| OP:NHOMO 536 OP:NHOMOORG 476 OP:PATTERN ---11-1-1111111-1------------------11-111111---2--1-11111-1-------11 -11------------------------------------------------------------------------------112122111-1-----------111-1-1---------------1---2---11----11111-11211111--1111111111-11121111111111111111--22--11---------------1111-1---111-1---------1------------------------------------------------------------------------------------------2--1----------1--11------1-----12--1-22112111121---11---1-----11111--121221------------121111111---111111111111-11-11-1----111---------11----------------------------------1-1--------1111111----11111111-1111------------------1---11111------------1-1-111-211121112-21211111111212211----------------------22111---1111111-1-----1-----1--1-11---2111-------1111-11111111111-111111111111111111111111--11111111111111111111111111----------------111111111111111------------------------1111111-1111----1111---------1----1111111111----------------21------------------------------------------221222112221- -----------111-11111111111111-1-1111-1--11111-11111-11111-1111111----1--111------1111111--2-11111111111111-1--2---------------------------------------------------111112112--1--2219-11222211112111111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 100.0 SQ:SECSTR cTTcEEEEEEEcccEEEEcHHHHHHTcTTccTccEEEEEEcccccEEEEEEccccHHHHHHHHHHHHHHcccccTTcccGGGTTccHHHHHHHHHHccEEEEEEETTEEcccTTcEEEEEEcccccEEEEEEEEEEEc PSIPRED ccEEEEEEEEccccEEEEHHHHHHHHHHHcccccEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHccEEEEEEEccEEccccEEEEEEEEEcccccEEEEEEEEEEc //