[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58166.1
DDBJ      :             cell division protein ZipA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  197/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.129.4
:298 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   152->283 1f7wA PDBj 3e-18 34.4 %
:HMM:SCOP  155->291 1f46A_ d.129.4.1 * 2.7e-40 46.3 %
:RPS:PFM   156->283 PF04354 * ZipA_C 5e-25 40.9 %
:HMM:PFM   157->283 PF04354 * ZipA_C 8.5e-47 52.8 127/131  
:BLT:SWISS 135->288 ZIPA_PSEF5 2e-26 37.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58166.1 GT:GENE ABA58166.1 GT:PRODUCT cell division protein ZipA GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1894611..1895507) GB:FROM 1894611 GB:TO 1895507 GB:DIRECTION - GB:PRODUCT cell division protein ZipA GB:PROTEIN_ID ABA58166.1 GB:DB_XREF GI:76883485 InterPro:IPR007449 InterPro:IPR011919 LENGTH 298 SQ:AASEQ MNDLRLALLMIGALILVVIYFYSRWENRRKDIREQERGRRRMPTLGTYDESLETPMEPAGGSQETSQKAMFNQSPQIPEKNQNLREQEEELLGNLENFDEPATLVEEAKETHSKKESECNEVIPPKDTKKSRFAFPKKWLKAKPRPEKLSPQPTGPELVIVLTVMARGKSMFRGKDIVRVLEDKGLRYGEMNIYHAYSPGGRAIFSVANIMEPGSFNLEQIERFSTTGLALFMRLPGAAGGFAAFDAMLEIARLLAEKLNGEVRDERRNILTAQALEQVRERILAFNRASRSLGAQGK GT:EXON 1|1-298:0| BL:SWS:NREP 1 BL:SWS:REP 135->288|ZIPA_PSEF5|2e-26|37.7|151/284| TM:NTM 1 TM:REGION 1->21| SEG 79->97|eknqnlreqeeellgnlen| SEG 237->247|gaaggfaafda| BL:PDB:NREP 1 BL:PDB:REP 152->283|1f7wA|3e-18|34.4|131/144| RP:PFM:NREP 1 RP:PFM:REP 156->283|PF04354|5e-25|40.9|127/131|ZipA_C| HM:PFM:NREP 1 HM:PFM:REP 157->283|PF04354|8.5e-47|52.8|127/131|ZipA_C| GO:PFM:NREP 4 GO:PFM GO:0000917|"GO:barrier septum formation"|PF04354|IPR007449| GO:PFM GO:0005515|"GO:protein binding"|PF04354|IPR007449| GO:PFM GO:0009276|"GO:Gram-negative-bacterium-type cell wall"|PF04354|IPR007449| GO:PFM GO:0016021|"GO:integral to membrane"|PF04354|IPR007449| HM:SCP:REP 155->291|1f46A_|2.7e-40|46.3|136/0|d.129.4.1|1/1|Cell-division protein ZipA, C-terminal domain| OP:NHOMO 198 OP:NHOMOORG 198 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111--1111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111----111111111111111111111111111---1111111111111111111---------11111111111111111111111111111----------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 131 STR:RPRED 44.0 SQ:SECSTR #######################################################################################################################################################cccccccEEEEEEEccTTccEEHHHHHHHHHHTTcEEETTTEEEEEcTTccEEEEEEEccTTccccTT#TTccEEcEEEEEEEccccccHHHHHHHHHHHHHHHHHHHTcEEEcTTcccccHHHHHHHHHHH############### DISOP:02AL 1-3, 27-153, 293-298| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHcccccccHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccccccHHHcccHHHHHccHHHHHHHHccccccccHHHHcccHHHHHcccHHHccccccccccEEEEEEEEcccccccHHHHHHHHHHcccEEccccEEEEEcccccHHHHHHHHHccccccHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccc //