[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58184.1
DDBJ      :             arginase
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  365/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.42.1
:309 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->289 1cevA PDBj 3e-43 37.1 %
:RPS:PDB   2->290 2ef4A PDBj 3e-56 39.9 %
:RPS:SCOP  1->290 1cevA  c.42.1.1 * 8e-55 41.1 %
:HMM:SCOP  2->294 2cevA_ c.42.1.1 * 4.6e-69 38.6 %
:RPS:PFM   69->285 PF00491 * Arginase 5e-39 43.3 %
:HMM:PFM   4->288 PF00491 * Arginase 9.3e-62 35.0 260/274  
:BLT:SWISS 2->289 ARGI_BREBE 6e-51 40.0 %
:PROS 219->240|PS01053|ARGINASE_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58184.1 GT:GENE ABA58184.1 GT:PRODUCT arginase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1916393..1917322) GB:FROM 1916393 GB:TO 1917322 GB:DIRECTION - GB:PRODUCT arginase GB:PROTEIN_ID ABA58184.1 GB:DB_XREF GI:76883503 InterPro:IPR005924 InterPro:IPR006035 LENGTH 309 SQ:AASEQ MKIIRIIGVASGWGALDRRCEAGPEALRRRGLVAHLRQQGMPVSWEITIQPQESQDDNAVMAVQALSVELSQVAGNVVARGEPFIVLGGDHSCAIGTWSGAVSRRRIAGPVGLIWIDAHMDAHLPETSPSGALHGMPLACLLGWGDPRLTAIGSPEPKFLPENVVLIGVRSFEPEEHRLLQRLGVKVFFMDEVRRRGLSEVFYEALGRIRDRTTGFGISLDLDAIDPKEAPAVGSPVPGGLAKEELLPLLRQLYGDPRLIGLEIAEYNPALDEKQLTARLISELLLSVFAPLRLPYESYHRAGKAVLSA GT:EXON 1|1-309:0| BL:SWS:NREP 1 BL:SWS:REP 2->289|ARGI_BREBE|6e-51|40.0|285/298| PROS 219->240|PS01053|ARGINASE_1|PDOC00135| BL:PDB:NREP 1 BL:PDB:REP 1->289|1cevA|3e-43|37.1|286/299| RP:PDB:NREP 1 RP:PDB:REP 2->290|2ef4A|3e-56|39.9|278/282| RP:PFM:NREP 1 RP:PFM:REP 69->285|PF00491|5e-39|43.3|201/266|Arginase| HM:PFM:NREP 1 HM:PFM:REP 4->288|PF00491|9.3e-62|35.0|260/274|Arginase| GO:PFM:NREP 2 GO:PFM GO:0016813|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines"|PF00491|IPR006035| GO:PFM GO:0046872|"GO:metal ion binding"|PF00491|IPR006035| RP:SCP:NREP 1 RP:SCP:REP 1->290|1cevA|8e-55|41.1|287/299|c.42.1.1| HM:SCP:REP 2->294|2cevA_|4.6e-69|38.6|290/298|c.42.1.1|1/1|Arginase/deacetylase| OP:NHOMO 916 OP:NHOMOORG 573 OP:PATTERN 221---112222222-12121-1-3--1--1---------------1---111-----1-11111--- 111-21-1-------------2---4------2555-1-1--11------111111-2--112--112121-----------2----------2------11-2121--1--------------------------21122---111-2---2----1-1--122-----1------------1112211-1322222212222222222422122221132-11------11111111111111111----1-----------------------------------------------------------------------111-------------11-----1---1----11-----2-------1-1-----------1-12211-1111111111111111-2111121113--622322433333-11--1-31111313--------1----1-------------------------------1--11--11111113111----11211111-12-1-3-1--21211111212222---1-----111111112-111112-1--1--1----212---1--1-21-1-1-----------1-11-1111--------1-------11--------------1--1----1---------11--1111111111111-1111111121111111111221--11-1111111111111111211111111----------------------------11------------------------1-----1-211-1121-----1----------11-11111111221111111111-------1------------------------------------------------------- 12----1-421-11121213112222211-2-111-13221221111122222311211111121211-1112211111112222111-11111211111211233-34243523421122233222525H3-535333241233332323333223124421532111121141---1M-----2123221212211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 97.4 SQ:SECSTR ccEEEEEEEccccccccccGGGHHHHHHHTTHHHHHHHHTcEEEcEEEEccccccccTTHHHHHHHHHHHHHHHHHTccTTEEEEEEEccGGGHHHHHHHHTTTccccccEEEEEEccccccccTTTcccccGGGcHHHHHTTcccHHHHHHHGccccccGGGEEEEEEccccHHHHHHHHHHTcEEEEHHHHHHHcHHHHHHHHHHHTTTccccEEEEEEGGGccTTTcccccccccccccHHHHHHHHHHHHHHTcEEEEEEEcccTTTccTTHHHHHHHHHHHHHTTHHTTccTTccc######## DISOP:02AL 303-309| PSIPRED ccEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccccHHHHHHHHHHcccHHHHHHcccccccccccEEEEEEccccHHHHHHHHHcccEEEEHHHHHHccHHHHHHHHHHHHcccccEEEEEEEEccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccc //