[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58185.1
DDBJ      :             metallo-beta-lactamase family protein
Swiss-Prot:             

Homologs  Archaea  49/68 : Bacteria  713/915 : Eukaryota  95/199 : Viruses  0/175   --->[See Alignment]
d.157.1
:212 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   5->208 2zwrB PDBj 6e-31 45.9 %
:RPS:PDB   1->207 3bk2A PDBj 2e-26 16.3 %
:RPS:SCOP  4->207 1qh3A  d.157.1.2 * 2e-31 19.8 %
:HMM:SCOP  1->208 1qh5A_ d.157.1.2 * 1.4e-58 45.7 %
:RPS:PFM   21->163 PF00753 * Lactamase_B 7e-14 38.4 %
:HMM:PFM   11->192 PF00753 * Lactamase_B 7.6e-34 29.2 178/194  
:BLT:SWISS 1->212 YCBL_ECOLI 6e-73 55.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58185.1 GT:GENE ABA58185.1 GT:PRODUCT metallo-beta-lactamase family protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1917594..1918232) GB:FROM 1917594 GB:TO 1918232 GB:DIRECTION - GB:PRODUCT metallo-beta-lactamase family protein GB:PROTEIN_ID ABA58185.1 GB:DB_XREF GI:76883504 InterPro:IPR001279 LENGTH 212 SQ:AASEQ MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELARRLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFFHPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGEKI GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->212|YCBL_ECOLI|6e-73|55.7|212/215| BL:PDB:NREP 1 BL:PDB:REP 5->208|2zwrB|6e-31|45.9|185/207| RP:PDB:NREP 1 RP:PDB:REP 1->207|3bk2A|2e-26|16.3|203/535| RP:PFM:NREP 1 RP:PFM:REP 21->163|PF00753|7e-14|38.4|138/171|Lactamase_B| HM:PFM:NREP 1 HM:PFM:REP 11->192|PF00753|7.6e-34|29.2|178/194|Lactamase_B| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF00753|IPR001279| RP:SCP:NREP 1 RP:SCP:REP 4->207|1qh3A|2e-31|19.8|182/260|d.157.1.2| HM:SCP:REP 1->208|1qh5A_|1.4e-58|45.7|184/260|d.157.1.2|1/1|Metallo-hydrolase/oxidoreductase| OP:NHOMO 1406 OP:NHOMOORG 857 OP:PATTERN 11----1111111112--11112215311213------1-1--121212121111111111---1-11 2122231455532334444-4633454444447667348824313-23-11-322222--23324551345-------1113411111111111111--3-111232222--------------2111--11----111221112122-11111111------112-1121------------12222--1333222222231223222123322322242112211111121233212322222322122111----------------------111111111111111111111111111-11111111111111111111211111111111111122111111111121111111111111111111-212133311111-32224432123122222222221-231241423231122221122123333322-1----2111111111111111212------------------------------43412-11-12222222111122221111112222323-322131222313111223431111111111111123115221111222111112111121211115244111111111111-1111111111111111134112-1111111-11111111111211-122121--11111111111111111111-1111111111111111111222111111111111111111111111111111111111111111111-1-----11112222-111111111111111222222212141322312222111111111--------111111111122111--1-1-----1---1-3111------------1-2--------------------------1----1---251 -----12-1--2122----11111121------------------------1-111--1211---------------------------12-------------11--22323122--1--11111-1-151-111-1111-11111-1111--1--125721312-11321-1---13M1111241352811---1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 212 STR:RPRED 100.0 SQ:SECSTR EEEEEEEcccccccEEEEEETccTEEEEEccccEEEEccHHHHHTGGGEEEEEcccccHHHHTTHHHHHHHHccccccEEEEEHHHHHHHHHHHHHTTccTTcTTcEEEEEcTTcEEEETTTEEEEEEEcccccccEEEEEEETTEEEEEccccccccccTTccccccHHHHHHHHHcccEEEEEcTTTTcccccccHHHHHHHHHHHHHHH PSIPRED cEEEEEEccccccEEEEEEEccccEEEEEcccccHHHHHHHHHHccccEEEEEEcccccccccHHHHHHHHcccEEEEcHHHHHHHHccccHHHHHccccccccccccEEEEcccEEEEccEEEEEEEEcccccccEEEEEccccEEEEEEEEccccccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHccHHcccc //