[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58186.1
DDBJ      :             ErfK/YbiS/YcfS/YnhG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:213 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  33->191 1zatA1  b.160.1.1 * 6e-09 16.7 %
:HMM:SCOP  24->192 1y7mA1 b.160.1.1 * 8.2e-18 31.0 %
:HMM:PFM   34->190 PF03734 * YkuD 1.6e-17 27.9 111/116  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58186.1 GT:GENE ABA58186.1 GT:PRODUCT ErfK/YbiS/YcfS/YnhG GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1918249..1918890) GB:FROM 1918249 GB:TO 1918890 GB:DIRECTION - GB:PRODUCT ErfK/YbiS/YcfS/YnhG GB:PROTEIN_ID ABA58186.1 GB:DB_XREF GI:76883505 InterPro:IPR005490 LENGTH 213 SQ:AASEQ MPNLLLKLLVILALVLTNPFAGATSSTELSYELIIIKSKRLLIVKKGGQIIKKYHAALGQGGGGGKRIEGDKHTPEGEYEIVGFWPSHKFHYFIHLDYPSRGDALAGYKEGLISWDELVHIYRAQQEKNGIPPQQTRLGGFIGIHGIGEETRKKLMIHRNFNWTRGCVALTNREIDELRQFIQLGTPVIILNEFNDKSLLAGMKVESGVSLTN GT:EXON 1|1-213:0| TM:NTM 1 TM:REGION 1->23| SEG 4->16|lllkllvilalvl| SEG 59->65|gqggggg| SEG 139->148|ggfigihgig| HM:PFM:NREP 1 HM:PFM:REP 34->190|PF03734|1.6e-17|27.9|111/116|YkuD| RP:SCP:NREP 1 RP:SCP:REP 33->191|1zatA1|6e-09|16.7|120/126|b.160.1.1| HM:SCP:REP 24->192|1y7mA1|8.2e-18|31.0|116/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 52 OP:NHOMOORG 49 OP:PATTERN -------------------------------------------------------------------- -1----------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----------------1---------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11----3--------------------1---------1-------------------------11------1---11111111121111111111---111-------------------------------------------------------------------------------------------------------1--1------------------------1-1---------1----111--------------------111-1------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 211-213| PSIPRED ccHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccEEEEEEEccEEEEEEEEEEccccccccccccccccccEEEEEEEEEccccccEEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEcccccccccEEccccccccEEEEcHHHHHHHHHHcccccEEEEEccccccHHHHcccHHHcccccc //