[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58187.1
DDBJ      :             Protein of unknown function DUF482
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  268/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:377 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  208->316 1ne9A2  d.108.1.4 * 5e-07 13.2 %
:HMM:SCOP  177->356 1lrzA3 d.108.1.4 * 1.8e-35 32.4 %
:RPS:PFM   8->375 PF04339 * DUF482 e-108 52.9 %
:HMM:PFM   8->375 PF04339 * DUF482 4.1e-149 50.7 367/370  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58187.1 GT:GENE ABA58187.1 GT:PRODUCT Protein of unknown function DUF482 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1918987..1920120) GB:FROM 1918987 GB:TO 1920120 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF482 GB:PROTEIN_ID ABA58187.1 GB:DB_XREF GI:76883506 InterPro:IPR007434 LENGTH 377 SQ:AASEQ MEFKVTESIETVASGQWNALEGTDNPFLRYEFLSALERYGCVGAHVGWLPRYLLAEDRPGSLIGAVPLYLKYNSFGEFVFDWSWADAWEQAGQHYYPKLVVAVPFSPVTGPRLLLKPGADEAMVDELIQMTIRLAKKGGISSLHWLFPHQKDRKRLANCGFLLRQGYQFHWHNRGYRDFNDFLETLTSKRRKEVRRERRQAQTRGTEIKVIHGSEVTDLEWRAMYRFYQATFHAKGNYPALTLPFFKSLGRTMGQAVVLALAVRTGIPIAGALYLRSRDTLYGRYWGDSEYLAGMHFELCYYRGIEYCIEHHLQYFEPGAQGEHKINRGFLPVLTWSAHWLGDSGFYSAIADFLAQESRMVRSAIMELEAGGPYKRP GT:EXON 1|1-377:0| SEG 189->199|krrkevrrerr| RP:PFM:NREP 1 RP:PFM:REP 8->375|PF04339|e-108|52.9|367/369|DUF482| HM:PFM:NREP 1 HM:PFM:REP 8->375|PF04339|4.1e-149|50.7|367/370|DUF482| RP:SCP:NREP 1 RP:SCP:REP 208->316|1ne9A2|5e-07|13.2|106/171|d.108.1.4| HM:SCP:REP 177->356|1lrzA3|1.8e-35|32.4|170/0|d.108.1.4|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 282 OP:NHOMOORG 279 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------1111111111111111111111111111111111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111------------------------------1111-111111111111111111111111111111111111111111111111111111111----------111------1---11-------------111121-1------------------------------1111111--111111-111111111-1---1--1------------1-------------------------------------------------------------------------------1---------11111----------------------1111111111111111111111---------1--------------11111111121111----111111------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-----111112-111------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 374-377| PSIPRED cEEEEEccHHcccHHHHHHHccccccEEEHHHHHHHHHccccccccccccEEEEEEEccccEEEEEEHHHcccccccccccHHHHHHHHHcccHHcHHHEEccccccccccEEcccccccHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHccccEEcccccEEEEccccccHHHHHHHHcHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccEEEEEEEEccEEEEEEEEEEEccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEccccHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //