[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58188.1
DDBJ      :             transcriptional regulator, BadM/Rrf2 family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  349/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->69 2b0lA PDBj 4e-06 17.0 %
:RPS:SCOP  18->69 1fp2A1  a.4.5.29 * 3e-07 21.2 %
:HMM:SCOP  2->132 1ylfA1 a.4.5.55 * 7.5e-28 34.9 %
:RPS:PFM   1->69 PF02082 * Rrf2 2e-12 46.4 %
:HMM:PFM   1->83 PF02082 * Rrf2 2.1e-27 42.2 83/83  
:BLT:SWISS 1->126 ISCR_VIBCH 8e-21 43.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58188.1 GT:GENE ABA58188.1 GT:PRODUCT transcriptional regulator, BadM/Rrf2 family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 1920232..1920657 GB:FROM 1920232 GB:TO 1920657 GB:DIRECTION + GB:PRODUCT transcriptional regulator, BadM/Rrf2 family GB:PROTEIN_ID ABA58188.1 GB:DB_XREF GI:76883507 InterPro:IPR000944 LENGTH 141 SQ:AASEQ MRFSNRPRYAISAMMNLALVKQQKSITLGDIAQLDNISVSYLEQIFASLRHHGLVEGIRGPGGGYHLTRAAEKITIAEIIAAVDKQPGKLNPLAIATNSVSEAERLWHDFSMRLYDFLNQITLADLARRWPHSHLGIKHGC GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 1->126|ISCR_VIBCH|8e-21|43.0|121/173| SEG 70->82|aaekitiaeiiaa| RP:PDB:NREP 1 RP:PDB:REP 17->69|2b0lA|4e-06|17.0|53/98| RP:PFM:NREP 1 RP:PFM:REP 1->69|PF02082|2e-12|46.4|69/83|Rrf2| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF02082|2.1e-27|42.2|83/83|Rrf2| RP:SCP:NREP 1 RP:SCP:REP 18->69|1fp2A1|3e-07|21.2|52/101|a.4.5.29| HM:SCP:REP 2->132|1ylfA1|7.5e-28|34.9|129/0|a.4.5.55|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 370 OP:NHOMOORG 349 OP:PATTERN -------------------------------------------------------------------- --1---------------------------------------------------------------------------1--2-----------------------------------------------------------------1----1--------------1111------------1-------1-1---------------111111---1---111------11-------------------1----------------------------------------------------------------------1111-1111111-1-1-----112241--1-1-221---1111---1------1111----------------------------------------2---------------1-11111111111-------------111-----221--11---1--11---------1-----11111111111111111111111111111111111111111221212111111111111111111112111-----1--1--111-121-2112----------------------------------11111111111111111111111111111111---2112------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111---1---------11-11111111111111111111111111111111111111111-1111---------111111111111111--------------11--------------------------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 63 STR:RPRED 44.7 SQ:SECSTR cc#ccHHHHHH#####TcccTTEEEEcHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEcccccEEEEE######################################################################## DISOP:02AL 135-136| PSIPRED cccccHHHHHHHHHHHHHHcccccEEEHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccccccccHHHccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccc //