[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58239.1
DDBJ      :             Cytochrome c oxidase, subunit II
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  424/915 : Eukaryota  58/199 : Viruses  0/175   --->[See Alignment]
a.3.1b.6.1
:352 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   127->233 1v54B PDBj 9e-18 36.4 %
:RPS:PDB   136->240 1cywA PDBj 1e-22 29.7 %
:RPS:PDB   264->351 1co6A PDBj 1e-11 24.7 %
:RPS:SCOP  136->238 1cywA  b.6.1.2 * 9e-23 30.3 %
:RPS:SCOP  264->351 1c52A  a.3.1.1 * 2e-11 18.8 %
:HMM:SCOP  127->303 1fftB1 b.6.1.2 * 4.1e-47 46.1 %
:HMM:SCOP  255->353 1yebA_ a.3.1.1 * 3.4e-18 33.0 %
:RPS:PFM   136->237 PF00116 * COX2 7e-19 42.2 %
:RPS:PFM   264->349 PF00034 * Cytochrom_C 1e-05 40.2 %
:HMM:PFM   153->236 PF00116 * COX2 3.6e-22 39.3 84/120  
:HMM:PFM   262->349 PF00034 * Cytochrom_C 2.5e-11 29.9 87/91  
:HMM:PFM   63->117 PF05656 * DUF805 0.00023 19.1 47/120  
:HMM:PFM   5->87 PF03595 * C4dic_mal_tran 0.00027 18.1 83/287  
:BLT:SWISS 138->352 COX2_BACPF 1e-27 30.8 %
:PROS 183->231|PS00078|COX2
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58239.1 GT:GENE ABA58239.1 GT:PRODUCT Cytochrome c oxidase, subunit II GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(1989467..1990525) GB:FROM 1989467 GB:TO 1990525 GB:DIRECTION - GB:PRODUCT Cytochrome c oxidase, subunit II GB:PROTEIN_ID ABA58239.1 GB:DB_XREF GI:76883558 InterPro:IPR001505 InterPro:IPR002327 InterPro:IPR002429 LENGTH 352 SQ:AASEQ MLLSIGAVSLKTVRRIRSIRHLLRGNISGAFLGASVLGIMGCEGPQSALNPAGRGAEQIAQLFWWLVAVNTLIWILVVGLAVYAAQLRPGAHPHRRAKLLIIGGGVIFPILVLTIYLTYGLSLMPALLKPADSDDLQIAVSGEQWWWRVRYLSSSGGEVIELANEIRLPLGESVNLLLDSPDVIHSFWVPSLTGKMDMIPGRISRLTLKATKVGVYHGVCAEYCGSAHALMKLDVVVMTPDAFAAWLAAQGQPAAVPQQALAARGQELFQFEGCSACHTIRGTAADGQVGPDLTHVGSRLSLGAGTLPNKPAAFLRWIAHTEKVKPGVHMPAFGMLPEKDLRALAMFLEGLQ GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 138->352|COX2_BACPF|1e-27|30.8|208/342| PROS 183->231|PS00078|COX2|PDOC00075| TM:NTM 3 TM:REGION 23->45| TM:REGION 62->84| TM:REGION 102->124| SEG 242->263|afaawlaaqgqpaavpqqalaa| BL:PDB:NREP 1 BL:PDB:REP 127->233|1v54B|9e-18|36.4|107/226| RP:PDB:NREP 2 RP:PDB:REP 136->240|1cywA|1e-22|29.7|101/159| RP:PDB:REP 264->351|1co6A|1e-11|24.7|85/107| RP:PFM:NREP 2 RP:PFM:REP 136->237|PF00116|7e-19|42.2|102/119|COX2| RP:PFM:REP 264->349|PF00034|1e-05|40.2|82/89|Cytochrom_C| HM:PFM:NREP 4 HM:PFM:REP 153->236|PF00116|3.6e-22|39.3|84/120|COX2| HM:PFM:REP 262->349|PF00034|2.5e-11|29.9|87/91|Cytochrom_C| HM:PFM:REP 63->117|PF05656|0.00023|19.1|47/120|DUF805| HM:PFM:REP 5->87|PF03595|0.00027|18.1|83/287|C4dic_mal_tran| GO:PFM:NREP 6 GO:PFM GO:0004129|"GO:cytochrome-c oxidase activity"|PF00116|IPR002429| GO:PFM GO:0005507|"GO:copper ion binding"|PF00116|IPR002429| GO:PFM GO:0016020|"GO:membrane"|PF00116|IPR002429| GO:PFM GO:0005506|"GO:iron ion binding"|PF00034|IPR003088| GO:PFM GO:0009055|"GO:electron carrier activity"|PF00034|IPR003088| GO:PFM GO:0020037|"GO:heme binding"|PF00034|IPR003088| RP:SCP:NREP 2 RP:SCP:REP 136->238|1cywA|9e-23|30.3|99/159|b.6.1.2| RP:SCP:REP 264->351|1c52A|2e-11|18.8|85/131|a.3.1.1| HM:SCP:REP 127->303|1fftB1|4.1e-47|46.1|165/166|b.6.1.2|1/1|Cupredoxins| HM:SCP:REP 255->353|1yebA_|3.4e-18|33.0|97/108|a.3.1.1|1/1|Cytochrome c| OP:NHOMO 682 OP:NHOMOORG 501 OP:PATTERN 11------1111111---1-1---311111------------------------------------11 114-1----------1111-1-1111111111------11111111111111111111111111-111111------------2---------------------1111---------------------------22222---12132211111112122112212433211111111111111-11---2122222222222222221111122211211112111-11211---------------------------------------------------------------------------------------------------------------------1---------------------1-11112-----12221331121221111111-111122432423432-211133224343111112113333-11--------111-112-111111111111111111111111-111111111--111232222321111223322222122423221122221111112161211111111-------1133211-----11---111-1-1-1111-222222---------------------------11---211112111111111111111111111---31-1--------------------------------------------------------------------------------------------1-----1111111---------------------------2111111111211112----11111111----2-----1111111111111111---11--111111-----------------------------------------------2- 11------1-----1--1---------11--11111-------111--------111-----1-111---------1----------------1---11-1---11------11111-----1-11-1-16--11-----1--11--------1-1-------2--12--1-11-111-------1--1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 83.8 SQ:SECSTR #######################################################ccccEEEEEEcccTTcHHHHHTTTc##EEEEEEEcTccEEcTTccEEcccEHHHHHHHHHHHHHHHHHHHcGGGGGcccTEEEEEEEETTEEEEEEETTTTEEEEEEEcEEEEETTcEEEEEEEEccccEEEEEGGGTEEEEEcTTccEEEEEEccccEEEEEcccccccTTTTTccEEEEEEccHccccccccGGGHHHHHHHHHHHHcccTTTTccHHHHHccTTTccccEETTcTTcEETTEEccccccTTccEEETTTTEEHHHHHHHHTTTccccTTcHHHHHHHHHHHHHc DISOP:02AL 250-261| PSIPRED cEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccEEEEEEEEEEEEEEEEccccccEEEEEccEEEEcccccEEEEEEEcHHHHHHHHHHHccEEccccccEEEEEEEEcccEEEEEEEHHHcccccccccEEEEEEcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccEEEEcccccccccccccccccccccEEcccccccccHHHHHHHHccHHHccccccccccccccHHHHHHHHHHHHHcc //