[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58248.1
DDBJ      :             Protein-methionine-S-oxide reductase
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  781/915 : Eukaryota  183/199 : Viruses  0/175   --->[See Alignment]
d.58.28
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   42->191 2iemA PDBj 4e-36 54.1 %
:RPS:PDB   41->208 3e0mC PDBj 8e-63 32.3 %
:RPS:SCOP  41->191 1ff3A  d.58.28.1 * 1e-64 49.7 %
:HMM:SCOP  1->205 1ff3A_ d.58.28.1 * 7.4e-75 44.9 %
:RPS:PFM   42->191 PF01625 * PMSR 2e-48 60.4 %
:HMM:PFM   41->194 PF01625 * PMSR 7e-70 54.2 153/156  
:BLT:SWISS 42->209 MSRA_BACLD 3e-56 56.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58248.1 GT:GENE ABA58248.1 GT:PRODUCT Protein-methionine-S-oxide reductase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 2003634..2004272 GB:FROM 2003634 GB:TO 2004272 GB:DIRECTION + GB:PRODUCT Protein-methionine-S-oxide reductase GB:PROTEIN_ID ABA58248.1 GB:DB_XREF GI:76883567 InterPro:IPR002569 LENGTH 212 SQ:AASEQ MTEKIKTREQFLTHGLMVLCLVVLIGLRPALALEAGKAPAKATFAGGCFWCMEPPFDNLEGVISTTSGYIGGHMKNPTYETVSGGKTGHAEAVQISYDPNQISYAELLAIFWRNIDPLAENRQFCDHGSQYRSAIFYHNETQQRLAEESKAQLAQSGRFNQPIVTEIKLATQFYPAEAYHQNYYQKNPIRYKLYRFGCGRDQRLQELWGDAS GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 42->209|MSRA_BACLD|3e-56|56.0|168/181| TM:NTM 1 TM:REGION 10->32| BL:PDB:NREP 1 BL:PDB:REP 42->191|2iemA|4e-36|54.1|148/211| RP:PDB:NREP 1 RP:PDB:REP 41->208|3e0mC|8e-63|32.3|164/313| RP:PFM:NREP 1 RP:PFM:REP 42->191|PF01625|2e-48|60.4|149/156|PMSR| HM:PFM:NREP 1 HM:PFM:REP 41->194|PF01625|7e-70|54.2|153/156|PMSR| GO:PFM:NREP 3 GO:PFM GO:0016671|"GO:oxidoreductase activity, acting on sulfur group of donors, disulfide as acceptor"|PF01625|IPR002569| GO:PFM GO:0019538|"GO:protein metabolic process"|PF01625|IPR002569| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01625|IPR002569| RP:SCP:NREP 1 RP:SCP:REP 41->191|1ff3A|1e-64|49.7|151/211|d.58.28.1| HM:SCP:REP 1->205|1ff3A_|7.4e-75|44.9|205/0|d.58.28.1|1/1|Peptide methionine sulfoxide reductase| OP:NHOMO 1536 OP:NHOMOORG 995 OP:PATTERN ------11------1---------21113111211---1111-21111-1111-----1--1----11 132-111111111111111-11111211111111111111111111111111111111--11111111111-11111111111-----1111-111---11212241242--------------111111111111111111112-222211211222222221212223122222222222211111--111122222222222222222111122221132331111111633333323333333333333112122321-133112211111222211122222112222222222222222222222222112221111-11112222222-2--111-111111111----221----1------1221-22222-----133222122222211111111111-22122133222-2111223222331223122111112221111111113311111-----------------------------122241111122222222111122421111112231213-11111111121212112221111-111111111221111212112111111111122121111212111111111111111111111111-11211222221422433322223252222222222---2211------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---211111223212122111-1--1111111111111112321211211233111111111222122222122212222233333221111111111111111221122--------111----1-1111-11---11111-1111-11------111 ----111-21111111111111111111111111111111111111111111111111-1--31111111111111111111111111-11111-111111-1222-1E122322211111-1121111461-2141111111111111-111111112211141113221-1221456c344235346167844222B ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 171 STR:RPRED 80.7 SQ:SECSTR #####################################ccEEEEEEcccHHHHHHHHHTcTTEEEEEEEEEccccccccTTTHHHHHHTcEEEEEEEEETTTccHHHHHHHHHHHcccccccEETTEEcGGGccEEEEccGGGHHHHHHHHHHHHHHHHHccccccEEEEcccEEEccTTTTTHHHHcTTccccccGGGGGcccccGGG#### DISOP:02AL 1-5, 210-212| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccHHHHHHHHHHcccEEEEEEEEcccccccccHHHHHccccccEEEEEEEEccccccHHHHHHHHHHHccccccccEEcccccccccEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHcccccEEEEEcccHHHHHHHHccccc //