[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA58261.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->117 PF04454 * Linocin_M18 0.00019 17.6 85/255  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA58261.1 GT:GENE ABA58261.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(2020623..2021009) GB:FROM 2020623 GB:TO 2021009 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA58261.1 GB:DB_XREF GI:76883580 LENGTH 128 SQ:AASEQ MLKKLSCLGIAIFLILSIPLSQGESHERYEKFIPINYALGMDEKYTATGSIVAVDKEEKIVTISANSESHAYKVTDDTKIWLDRSQIKAKNMEGSLTDLKKGLKAEIKIYSTEDKAVAKWIKVQIINN GT:EXON 1|1-128:0| TM:NTM 1 TM:REGION 5->20| HM:PFM:NREP 1 HM:PFM:REP 31->117|PF04454|0.00019|17.6|85/255|Linocin_M18| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccHHHHHHHHHHHHHccccccccccHHHHcccEEEEEcccccEEccccEEEEccccEEEEEEccccccEEEEccccEEEEEccHHEEccccccHHHHHcccEEEEEEEEcccHHHEEEEEEEEEcc //